Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/Xre(antitoxin)
Location 53645..54146 Replicon plasmid unnamed4
Accession NZ_CP122827
Organism Escherichia coli strain ETEC1732

Toxin (Protein)


Gene name TsxA Uniprot ID A0A6X6XTU7
Locus tag QDX01_RS26885 Protein ID WP_000702245.1
Coordinates 53645..53905 (+) Length 87 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID -
Locus tag QDX01_RS26890 Protein ID WP_000931278.1
Coordinates 53895..54146 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX01_RS26850 (49652) 49652..49999 - 348 WP_000624618.1 IS66 family insertion sequence element accessory protein TnpB -
QDX01_RS26855 (49999) 49999..50649 - 651 WP_000993956.1 IS66-like element accessory protein TnpA -
QDX01_RS26860 (50737) 50737..51192 - 456 Protein_65 division plane positioning ATPase MipZ -
QDX01_RS26865 (51790) 51790..52119 + 330 WP_000855121.1 hypothetical protein -
QDX01_RS26870 (52698) 52698..53021 + 324 WP_000427402.1 hypothetical protein -
QDX01_RS26875 (53062) 53062..53271 + 210 WP_000866037.1 hypothetical protein -
QDX01_RS26880 (53369) 53369..53593 + 225 WP_000814383.1 hypothetical protein -
QDX01_RS26885 (53645) 53645..53905 + 261 WP_000702245.1 hypothetical protein Toxin
QDX01_RS26890 (53895) 53895..54146 + 252 WP_000931278.1 transcriptional regulator Antitoxin
QDX01_RS26895 (54695) 54695..54973 + 279 WP_000545937.1 hypothetical protein -
QDX01_RS26900 (55438) 55438..55686 + 249 WP_000513532.1 type II toxin-antitoxin system HicA family toxin -
QDX01_RS26905 (55683) 55683..56030 + 348 WP_000681609.1 type II toxin-antitoxin system HicB family antitoxin -
QDX01_RS26910 (56241) 56241..57449 - 1209 WP_000198533.1 IS91 family transposase -
QDX01_RS26915 (57430) 57430..57702 - 273 WP_000019163.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid aadA5 / sul2 - 1..80827 80827


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-37)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 9818.23 Da        Isoelectric Point: 9.5163

>T277981 WP_000702245.1 NZ_CP122827:53645-53905 [Escherichia coli]
MKIRKGDRQYYLNKEGDTFHLVKRVKTFSKSATLGKTKATVKTVADLVFHEEAFDTIDFASDGLRENDKEIVSMMIQEMS
EGKNAK

Download         Length: 261 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9420.81 Da        Isoelectric Point: 9.8120

>AT277981 WP_000931278.1 NZ_CP122827:53895-54146 [Escherichia coli]
MLNENTPENIKRLRQKIGLTQKECAEIFSMSPRTWRRKEEPVGTASGTALTPVEFKFLLLLAGEHPDYVLCKRNKKNSDS
GSN

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6X6XTU7

Antitoxin

Source ID Structure

References