Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 20674..21275 Replicon plasmid unnamed6
Accession NZ_CP122822
Organism Escherichia coli strain ETEC1731

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag QDY29_RS26350 Protein ID WP_001216034.1
Coordinates 20674..21054 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QDY29_RS26355 Protein ID WP_001190712.1
Coordinates 21054..21275 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY29_RS26325 (QDY29_26325) 16115..17599 - 1485 WP_000124164.1 terminase -
QDY29_RS26330 (QDY29_26330) 17599..18792 - 1194 WP_000219621.1 hypothetical protein -
QDY29_RS26335 (QDY29_26335) 18878..19330 - 453 WP_001326849.1 late promoter-activating protein -
QDY29_RS26340 (QDY29_26340) 19419..20462 - 1044 WP_282843053.1 DUF968 domain-containing protein -
QDY29_RS26345 (QDY29_26345) 20490..20669 - 180 WP_000113018.1 hypothetical protein -
QDY29_RS26350 (QDY29_26350) 20674..21054 - 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QDY29_RS26355 (QDY29_26355) 21054..21275 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QDY29_RS26360 (QDY29_26360) 21348..21737 - 390 WP_000506730.1 S24 family peptidase -
QDY29_RS26365 (QDY29_26365) 21912..22496 + 585 WP_001111503.1 hypothetical protein -
QDY29_RS26370 (QDY29_26370) 22497..22859 + 363 WP_001062543.1 hypothetical protein -
QDY29_RS26375 (QDY29_26375) 22871..23110 - 240 WP_001423760.1 DNA polymerase III subunit theta -
QDY29_RS26380 (QDY29_26380) 24255..25811 + 1557 WP_000200814.1 type I restriction-modification system subunit M -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..99950 99950


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T277959 WP_001216034.1 NZ_CP122822:c21054-20674 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT277959 WP_001190712.1 NZ_CP122822:c21275-21054 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References