Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 20674..21275 | Replicon | plasmid unnamed6 |
| Accession | NZ_CP122822 | ||
| Organism | Escherichia coli strain ETEC1731 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | V0AJ64 |
| Locus tag | QDY29_RS26350 | Protein ID | WP_001216034.1 |
| Coordinates | 20674..21054 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | QDY29_RS26355 | Protein ID | WP_001190712.1 |
| Coordinates | 21054..21275 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY29_RS26325 (QDY29_26325) | 16115..17599 | - | 1485 | WP_000124164.1 | terminase | - |
| QDY29_RS26330 (QDY29_26330) | 17599..18792 | - | 1194 | WP_000219621.1 | hypothetical protein | - |
| QDY29_RS26335 (QDY29_26335) | 18878..19330 | - | 453 | WP_001326849.1 | late promoter-activating protein | - |
| QDY29_RS26340 (QDY29_26340) | 19419..20462 | - | 1044 | WP_282843053.1 | DUF968 domain-containing protein | - |
| QDY29_RS26345 (QDY29_26345) | 20490..20669 | - | 180 | WP_000113018.1 | hypothetical protein | - |
| QDY29_RS26350 (QDY29_26350) | 20674..21054 | - | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| QDY29_RS26355 (QDY29_26355) | 21054..21275 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QDY29_RS26360 (QDY29_26360) | 21348..21737 | - | 390 | WP_000506730.1 | S24 family peptidase | - |
| QDY29_RS26365 (QDY29_26365) | 21912..22496 | + | 585 | WP_001111503.1 | hypothetical protein | - |
| QDY29_RS26370 (QDY29_26370) | 22497..22859 | + | 363 | WP_001062543.1 | hypothetical protein | - |
| QDY29_RS26375 (QDY29_26375) | 22871..23110 | - | 240 | WP_001423760.1 | DNA polymerase III subunit theta | - |
| QDY29_RS26380 (QDY29_26380) | 24255..25811 | + | 1557 | WP_000200814.1 | type I restriction-modification system subunit M | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..99950 | 99950 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T277959 WP_001216034.1 NZ_CP122822:c21054-20674 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AJ64 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |