277958

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/Xre(antitoxin)
Location 31058..31556 Replicon plasmid unnamed5
Accession NZ_CP122821
Organism Escherichia coli strain ETEC1731

Toxin (Protein)


Gene name TsxA Uniprot ID A0A764VNK7
Locus tag QDY29_RS26075 Protein ID WP_000868275.1
Coordinates 31290..31556 (-) Length 89 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID A0A3H7VMJ5
Locus tag QDY29_RS26070 Protein ID WP_001450803.1
Coordinates 31058..31300 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY29_RS26035 (QDY29_26035) 26153..26914 + 762 WP_001097938.1 conjugal transfer protein TraL -
QDY29_RS26040 (QDY29_26040) 26911..27615 + 705 WP_001279864.1 hypothetical protein -
QDY29_RS26045 (QDY29_26045) 27644..28081 - 438 WP_000466317.1 type II toxin-antitoxin system HicB family antitoxin -
QDY29_RS26050 (QDY29_26050) 28106..28288 - 183 WP_000833471.1 type II toxin-antitoxin system HicA family toxin -
QDY29_RS26055 (QDY29_26055) 28484..28762 - 279 WP_000545935.1 cobalamin biosynthesis protein CbiX -
QDY29_RS26060 (QDY29_26060) 29088..29270 - 183 WP_000449470.1 hypothetical protein -
QDY29_RS26065 (QDY29_26065) 29372..30483 + 1112 Protein_26 IS4-like element IS421 family transposase -
QDY29_RS26070 (QDY29_26070) 31058..31300 - 243 WP_001450803.1 hypothetical protein Antitoxin
QDY29_RS26075 (QDY29_26075) 31290..31556 - 267 WP_000868275.1 hypothetical protein Toxin
QDY29_RS26080 (QDY29_26080) 31607..31831 - 225 WP_000749827.1 hypothetical protein -
QDY29_RS26085 (QDY29_26085) 31927..32151 - 225 WP_000866040.1 hypothetical protein -
QDY29_RS26090 (QDY29_26090) 32193..32516 - 324 WP_000432878.1 hypothetical protein -
QDY29_RS26095 (QDY29_26095) 33811..34614 + 804 WP_000210482.1 replication initiation protein -
QDY29_RS26100 (QDY29_26100) 35793..36131 - 339 WP_000612443.1 helix-turn-helix transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - hlyA / hlyB / hlyB / hlyD / hlyC 1..63729 63729
- flank IS/Tn - - 29372..30646 1274


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10199.63 Da        Isoelectric Point: 9.5657

>T277958 WP_000868275.1 NZ_CP122821:c31556-31290 [Escherichia coli]
MKVRKGDRQYYLNKEGDTFHLVKRVKTFSKSATLGKTKATVITVADLIFHEDAFDTIDFTRGGLRENDKEVVSMMIQEMN
NEREKNVN

Download         Length: 267 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9288.69 Da        Isoelectric Point: 9.7120

>AT277958 WP_001450803.1 NZ_CP122821:c31300-31058 [Escherichia coli]
MLTENTPENIKRLRQKIGLTQRECAEIFSMNPRTWRRKEEPAGTASGTALTPVEFKYLQLLAGEHPEYVLRKRDKPKCSE

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A764VNK7

Antitoxin

Source ID Structure
AlphaFold DB A0A3H7VMJ5

References