Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 27644..28288 | Replicon | plasmid unnamed5 |
| Accession | NZ_CP122821 | ||
| Organism | Escherichia coli strain ETEC1731 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A7L6LII1 |
| Locus tag | QDY29_RS26050 | Protein ID | WP_000833471.1 |
| Coordinates | 28106..28288 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A7L6LHN8 |
| Locus tag | QDY29_RS26045 | Protein ID | WP_000466317.1 |
| Coordinates | 27644..28081 (-) | Length | 146 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY29_RS26025 (QDY29_26025) | 25067..25402 | - | 336 | WP_000963832.1 | DUF6290 family protein | - |
| QDY29_RS26030 (QDY29_26030) | 25736..26143 | + | 408 | WP_001190622.1 | hypothetical protein | - |
| QDY29_RS26035 (QDY29_26035) | 26153..26914 | + | 762 | WP_001097938.1 | conjugal transfer protein TraL | - |
| QDY29_RS26040 (QDY29_26040) | 26911..27615 | + | 705 | WP_001279864.1 | hypothetical protein | - |
| QDY29_RS26045 (QDY29_26045) | 27644..28081 | - | 438 | WP_000466317.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QDY29_RS26050 (QDY29_26050) | 28106..28288 | - | 183 | WP_000833471.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QDY29_RS26055 (QDY29_26055) | 28484..28762 | - | 279 | WP_000545935.1 | cobalamin biosynthesis protein CbiX | - |
| QDY29_RS26060 (QDY29_26060) | 29088..29270 | - | 183 | WP_000449470.1 | hypothetical protein | - |
| QDY29_RS26065 (QDY29_26065) | 29372..30483 | + | 1112 | Protein_26 | IS4-like element IS421 family transposase | - |
| QDY29_RS26070 (QDY29_26070) | 31058..31300 | - | 243 | WP_001450803.1 | hypothetical protein | - |
| QDY29_RS26075 (QDY29_26075) | 31290..31556 | - | 267 | WP_000868275.1 | hypothetical protein | - |
| QDY29_RS26080 (QDY29_26080) | 31607..31831 | - | 225 | WP_000749827.1 | hypothetical protein | - |
| QDY29_RS26085 (QDY29_26085) | 31927..32151 | - | 225 | WP_000866040.1 | hypothetical protein | - |
| QDY29_RS26090 (QDY29_26090) | 32193..32516 | - | 324 | WP_000432878.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | hlyA / hlyB / hlyB / hlyD / hlyC | 1..63729 | 63729 | |
| - | flank | IS/Tn | - | - | 29372..30646 | 1274 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6675.97 Da Isoelectric Point: 11.0013
>T277957 WP_000833471.1 NZ_CP122821:c28288-28106 [Escherichia coli]
MKSADLLKELIAAGCELKRHKASSHQIWWSPITGKTFPVPHPKKDLPLGTVRSIRKMAGI
MKSADLLKELIAAGCELKRHKASSHQIWWSPITGKTFPVPHPKKDLPLGTVRSIRKMAGI
Download Length: 183 bp
Antitoxin
Download Length: 146 a.a. Molecular weight: 16227.10 Da Isoelectric Point: 4.3135
>AT277957 WP_000466317.1 NZ_CP122821:c28081-27644 [Escherichia coli]
MFFSVGVETPKDDHTAYGITVPAFDRFDFGCVSAADTQSEIPVMAREAILAIVEEMVLSGSYSVDDIHDDGCLTYAANQD
YSHCDSWFVIDVDLSEIEGKQQRINIALPDVLIRRIDGFVRESGGVYRDRSHFLAQAARHELSYK
MFFSVGVETPKDDHTAYGITVPAFDRFDFGCVSAADTQSEIPVMAREAILAIVEEMVLSGSYSVDDIHDDGCLTYAANQD
YSHCDSWFVIDVDLSEIEGKQQRINIALPDVLIRRIDGFVRESGGVYRDRSHFLAQAARHELSYK
Download Length: 438 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7L6LII1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7L6LHN8 |