Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 47111..47646 Replicon plasmid unnamed1
Accession NZ_CP122817
Organism Escherichia coli strain ETEC1731

Toxin (Protein)


Gene name relE Uniprot ID Q60228
Locus tag QDY29_RS24525 Protein ID WP_001270417.1
Coordinates 47111..47398 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID L4J0V6
Locus tag QDY29_RS24530 Protein ID WP_001132895.1
Coordinates 47395..47646 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY29_RS24495 (42656) 42656..42765 + 110 Protein_48 IS5/IS1182 family transposase -
QDY29_RS24500 (43288) 43288..43538 + 251 Protein_49 type II toxin-antitoxin system ParD family antitoxin -
QDY29_RS24505 (43525) 43525..43819 + 295 Protein_50 type II toxin-antitoxin system RelE/ParE family toxin -
QDY29_RS24510 (44182) 44182..44922 + 741 WP_001066942.1 tyrosine-type recombinase/integrase -
QDY29_RS24515 (45207) 45207..46184 - 978 WP_000361610.1 RepB family plasmid replication initiator protein -
QDY29_RS24520 (46864) 46864..47109 - 246 Protein_53 integrase core domain-containing protein -
QDY29_RS24525 (47111) 47111..47398 - 288 WP_001270417.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QDY29_RS24530 (47395) 47395..47646 - 252 WP_001132895.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QDY29_RS24535 (47819) 47819..48031 - 213 WP_000402944.1 hypothetical protein -
QDY29_RS24540 (48405) 48405..49610 + 1206 WP_000817634.1 AAA family ATPase -
QDY29_RS24545 (49607) 49607..50569 + 963 WP_000756327.1 ParB family protein -
QDY29_RS24550 (50803) 50803..51580 + 778 Protein_59 transposase DNA-binding-containing protein -
QDY29_RS24555 (51710) 51710..51793 - 84 Protein_60 DUF4113 domain-containing protein -
QDY29_RS24560 (51795) 51795..52323 + 529 Protein_61 DUF1281 domain-containing protein -
QDY29_RS24565 (52320) 52320..52631 + 312 WP_001309256.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - eltB / eltA 1..91480 91480


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11214.24 Da        Isoelectric Point: 10.4703

>T277948 WP_001270417.1 NZ_CP122817:c47398-47111 [Escherichia coli]
MRYQVKFREDALKEWQKLDKAIQQQFAKKLKKCCDNPHIPSAKLRGIKDCYKIKLRASGFRLVYQVIDEQLIIAVVAVGK
RERSDVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9178.47 Da        Isoelectric Point: 4.2108

>AT277948 WP_001132895.1 NZ_CP122817:c47646-47395 [Escherichia coli]
MPNIILSDTSASVSELKKNPMATVSAGDGFPVAILNRNQPAFYCVPAELYEKMLDALDDQELVKLVAERSNQPLHDVDLD
KYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5T8BSB4

Antitoxin

Source ID Structure
AlphaFold DB L4J0V6

References