Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 18968..19515 Replicon plasmid unnamed1
Accession NZ_CP122817
Organism Escherichia coli strain ETEC1731

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag QDY29_RS24340 Protein ID WP_001384452.1
Coordinates 19237..19515 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A2I6FMZ7
Locus tag QDY29_RS24335 Protein ID WP_000079930.1
Coordinates 18968..19237 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY29_RS24305 (14079) 14079..14390 - 312 WP_000765906.1 hypothetical protein -
- (14686) 14686..14747 - 62 NuclAT_1 - -
- (14686) 14686..14747 - 62 NuclAT_1 - -
- (14686) 14686..14747 - 62 NuclAT_1 - -
- (14686) 14686..14747 - 62 NuclAT_1 - -
QDY29_RS24315 (16052) 16052..16192 + 141 WP_064717426.1 Hok/Gef family protein -
QDY29_RS24320 (16472) 16472..16729 + 258 WP_000083834.1 replication regulatory protein RepA -
QDY29_RS24325 (16963) 16963..17037 + 75 WP_032319616.1 RepA leader peptide Tap -
QDY29_RS24330 (17030) 17030..18052 + 1023 WP_000840938.1 plasmid replication initiator RepA -
QDY29_RS24335 (18968) 18968..19237 + 270 WP_000079930.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
QDY29_RS24340 (19237) 19237..19515 + 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
QDY29_RS24345 (19561) 19561..20290 + 730 Protein_18 3'-5' exonuclease -
QDY29_RS24350 (20297) 20297..20605 - 309 Protein_19 integrase core domain-containing protein -
QDY29_RS24355 (20622) 20622..21698 - 1077 WP_000907656.1 IS110-like element ISEc21 family transposase -
QDY29_RS24360 (21980) 21980..22839 - 860 Protein_21 IS3 family transposase -
QDY29_RS24365 (22953) 22953..23348 - 396 Protein_22 ATP-binding protein -
QDY29_RS24370 (23696) 23696..24070 - 375 WP_015675362.1 heat-labile enterotoxin LT subunit B -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - eltB / eltA 1..91480 91480
- inside IScluster/Tn - eltB / eltA 14824..40440 25616


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T277947 WP_001384452.1 NZ_CP122817:19237-19515 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10252.58 Da        Isoelectric Point: 7.2055

>AT277947 WP_000079930.1 NZ_CP122817:18968-19237 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVAAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVADK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A2I6FMZ7

References