Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4261709..4262541 | Replicon | chromosome |
| Accession | NZ_CP122816 | ||
| Organism | Escherichia coli strain ETEC1731 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | QDY29_RS20900 | Protein ID | WP_000854753.1 |
| Coordinates | 4261709..4262083 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | V0ULY5 |
| Locus tag | QDY29_RS20905 | Protein ID | WP_001315620.1 |
| Coordinates | 4262173..4262541 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY29_RS20860 (4256916) | 4256916..4258022 | + | 1107 | WP_001299704.1 | N-acetylneuraminate epimerase | - |
| QDY29_RS20865 (4258087) | 4258087..4259067 | + | 981 | WP_000991458.1 | sialate O-acetylesterase | - |
| QDY29_RS20870 (4259075) | 4259075..4259725 | - | 651 | WP_001037966.1 | HNH endonuclease | - |
| QDY29_RS20875 (4259862) | 4259862..4260005 | + | 144 | Protein_4082 | HNH endonuclease | - |
| QDY29_RS20880 (4260104) | 4260104..4260289 | + | 186 | WP_000066585.1 | hypothetical protein | - |
| QDY29_RS20885 (4260781) | 4260781..4260930 | - | 150 | Protein_4084 | hypothetical protein | - |
| QDY29_RS20890 (4261015) | 4261015..4261212 | - | 198 | WP_000839282.1 | DUF957 domain-containing protein | - |
| QDY29_RS20895 (4261224) | 4261224..4261712 | - | 489 | WP_000777548.1 | DUF5983 family protein | - |
| QDY29_RS20900 (4261709) | 4261709..4262083 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| QDY29_RS20905 (4262173) | 4262173..4262541 | - | 369 | WP_001315620.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QDY29_RS20910 (4262704) | 4262704..4262925 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QDY29_RS20915 (4262988) | 4262988..4263464 | - | 477 | WP_001186774.1 | RadC family protein | - |
| QDY29_RS20920 (4263480) | 4263480..4263965 | - | 486 | WP_000849588.1 | antirestriction protein | - |
| QDY29_RS20925 (4264020) | 4264020..4264838 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| QDY29_RS20930 (4264938) | 4264938..4265171 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| QDY29_RS20935 (4265250) | 4265250..4265705 | - | 456 | WP_000581504.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T277945 WP_000854753.1 NZ_CP122816:c4262083-4261709 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13474.20 Da Isoelectric Point: 6.2050
>AT277945 WP_001315620.1 NZ_CP122816:c4262541-4262173 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0ULY5 |