Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4261709..4262541 Replicon chromosome
Accession NZ_CP122816
Organism Escherichia coli strain ETEC1731

Toxin (Protein)


Gene name yeeV Uniprot ID S1PD64
Locus tag QDY29_RS20900 Protein ID WP_000854753.1
Coordinates 4261709..4262083 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID V0ULY5
Locus tag QDY29_RS20905 Protein ID WP_001315620.1
Coordinates 4262173..4262541 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY29_RS20860 (4256916) 4256916..4258022 + 1107 WP_001299704.1 N-acetylneuraminate epimerase -
QDY29_RS20865 (4258087) 4258087..4259067 + 981 WP_000991458.1 sialate O-acetylesterase -
QDY29_RS20870 (4259075) 4259075..4259725 - 651 WP_001037966.1 HNH endonuclease -
QDY29_RS20875 (4259862) 4259862..4260005 + 144 Protein_4082 HNH endonuclease -
QDY29_RS20880 (4260104) 4260104..4260289 + 186 WP_000066585.1 hypothetical protein -
QDY29_RS20885 (4260781) 4260781..4260930 - 150 Protein_4084 hypothetical protein -
QDY29_RS20890 (4261015) 4261015..4261212 - 198 WP_000839282.1 DUF957 domain-containing protein -
QDY29_RS20895 (4261224) 4261224..4261712 - 489 WP_000777548.1 DUF5983 family protein -
QDY29_RS20900 (4261709) 4261709..4262083 - 375 WP_000854753.1 TA system toxin CbtA family protein Toxin
QDY29_RS20905 (4262173) 4262173..4262541 - 369 WP_001315620.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QDY29_RS20910 (4262704) 4262704..4262925 - 222 WP_000692345.1 DUF987 domain-containing protein -
QDY29_RS20915 (4262988) 4262988..4263464 - 477 WP_001186774.1 RadC family protein -
QDY29_RS20920 (4263480) 4263480..4263965 - 486 WP_000849588.1 antirestriction protein -
QDY29_RS20925 (4264020) 4264020..4264838 - 819 WP_001234620.1 DUF932 domain-containing protein -
QDY29_RS20930 (4264938) 4264938..4265171 - 234 WP_001119729.1 DUF905 family protein -
QDY29_RS20935 (4265250) 4265250..4265705 - 456 WP_000581504.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14005.00 Da        Isoelectric Point: 8.2905

>T277945 WP_000854753.1 NZ_CP122816:c4262083-4261709 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13474.20 Da        Isoelectric Point: 6.2050

>AT277945 WP_001315620.1 NZ_CP122816:c4262541-4262173 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LVU0

Antitoxin

Source ID Structure
AlphaFold DB V0ULY5

References