Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3694188..3694806 | Replicon | chromosome |
Accession | NZ_CP122816 | ||
Organism | Escherichia coli strain ETEC1731 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QDY29_RS18205 | Protein ID | WP_001291435.1 |
Coordinates | 3694588..3694806 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QDY29_RS18200 | Protein ID | WP_000344800.1 |
Coordinates | 3694188..3694562 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDY29_RS18190 (3689277) | 3689277..3690470 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QDY29_RS18195 (3690493) | 3690493..3693642 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
QDY29_RS18200 (3694188) | 3694188..3694562 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QDY29_RS18205 (3694588) | 3694588..3694806 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QDY29_RS18210 (3694978) | 3694978..3695529 | + | 552 | WP_000102568.1 | maltose O-acetyltransferase | - |
QDY29_RS18215 (3695645) | 3695645..3696115 | + | 471 | WP_000136192.1 | YlaC family protein | - |
QDY29_RS18220 (3696279) | 3696279..3697829 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QDY29_RS18225 (3697871) | 3697871..3698224 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
QDY29_RS18235 (3698603) | 3698603..3698914 | + | 312 | WP_000409911.1 | MGMT family protein | - |
QDY29_RS18240 (3698945) | 3698945..3699517 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T277943 WP_001291435.1 NZ_CP122816:3694588-3694806 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT277943 WP_000344800.1 NZ_CP122816:3694188-3694562 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |