Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1936735..1937567 | Replicon | chromosome |
| Accession | NZ_CP122816 | ||
| Organism | Escherichia coli strain ETEC1731 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A7ZVJ9 |
| Locus tag | QDY29_RS09390 | Protein ID | WP_000854765.1 |
| Coordinates | 1936735..1937109 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | QDY29_RS09395 | Protein ID | WP_001384657.1 |
| Coordinates | 1937199..1937567 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY29_RS09355 (1932194) | 1932194..1932523 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| QDY29_RS09360 (1932624) | 1932624..1932890 | - | 267 | WP_001360325.1 | EutP/PduV family microcompartment system protein | - |
| QDY29_RS09365 (1933080) | 1933080..1933862 | - | 783 | WP_001317493.1 | IS21-like element IS100kyp family helper ATPase IstB | - |
| QDY29_RS09370 (1933859) | 1933859..1934881 | - | 1023 | WP_001372384.1 | IS21-like element IS100 family transposase | - |
| QDY29_RS09375 (1935219) | 1935219..1935608 | - | 390 | WP_077249349.1 | transposase | - |
| QDY29_RS09380 (1936406) | 1936406..1936486 | - | 81 | Protein_1838 | hypothetical protein | - |
| QDY29_RS09385 (1936586) | 1936586..1936738 | - | 153 | Protein_1839 | DUF5983 family protein | - |
| QDY29_RS09390 (1936735) | 1936735..1937109 | - | 375 | WP_000854765.1 | TA system toxin CbtA family protein | Toxin |
| QDY29_RS09395 (1937199) | 1937199..1937567 | - | 369 | WP_001384657.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QDY29_RS09400 (1937730) | 1937730..1937951 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QDY29_RS09405 (1938020) | 1938020..1938496 | - | 477 | WP_001186770.1 | RadC family protein | - |
| QDY29_RS09410 (1938512) | 1938512..1938985 | - | 474 | WP_001372806.1 | antirestriction protein | - |
| QDY29_RS09415 (1939327) | 1939327..1940145 | - | 819 | WP_001234651.1 | DUF932 domain-containing protein | - |
| QDY29_RS09420 (1940263) | 1940263..1940458 | - | 196 | Protein_1846 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13970.98 Da Isoelectric Point: 7.2909
>T277936 WP_000854765.1 NZ_CP122816:c1937109-1936735 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13521.22 Da Isoelectric Point: 5.4492
>AT277936 WP_001384657.1 NZ_CP122816:c1937567-1937199 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|