Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1407942..1408567 | Replicon | chromosome |
Accession | NZ_CP122816 | ||
Organism | Escherichia coli strain ETEC1731 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QDY29_RS06985 | Protein ID | WP_000911330.1 |
Coordinates | 1408169..1408567 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | QDY29_RS06980 | Protein ID | WP_000450524.1 |
Coordinates | 1407942..1408169 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDY29_RS06955 (1403746) | 1403746..1404216 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
QDY29_RS06960 (1404216) | 1404216..1404788 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
QDY29_RS06965 (1404934) | 1404934..1405812 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
QDY29_RS06970 (1405829) | 1405829..1406863 | + | 1035 | WP_001384714.1 | outer membrane protein assembly factor BamC | - |
QDY29_RS06975 (1407076) | 1407076..1407789 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
QDY29_RS06980 (1407942) | 1407942..1408169 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
QDY29_RS06985 (1408169) | 1408169..1408567 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QDY29_RS06990 (1408714) | 1408714..1409577 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
QDY29_RS06995 (1409592) | 1409592..1411607 | + | 2016 | WP_000829335.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
QDY29_RS07000 (1411681) | 1411681..1412379 | + | 699 | WP_000679812.1 | esterase | - |
QDY29_RS07005 (1412489) | 1412489..1412689 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T277934 WP_000911330.1 NZ_CP122816:1408169-1408567 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|