Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1079976..1080559 | Replicon | chromosome |
Accession | NZ_CP122816 | ||
Organism | Escherichia coli strain ETEC1731 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | QDY29_RS05330 | Protein ID | WP_000254738.1 |
Coordinates | 1080224..1080559 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | QDY29_RS05325 | Protein ID | WP_000581937.1 |
Coordinates | 1079976..1080224 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDY29_RS05315 (1076315) | 1076315..1077616 | + | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
QDY29_RS05320 (1077664) | 1077664..1079898 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
QDY29_RS05325 (1079976) | 1079976..1080224 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QDY29_RS05330 (1080224) | 1080224..1080559 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
QDY29_RS05335 (1080630) | 1080630..1081421 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
QDY29_RS05340 (1081649) | 1081649..1083286 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
QDY29_RS05345 (1083374) | 1083374..1084672 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T277932 WP_000254738.1 NZ_CP122816:1080224-1080559 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|