Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 809246..810081 | Replicon | chromosome |
| Accession | NZ_CP122816 | ||
| Organism | Escherichia coli strain ETEC1731 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A7W4PV54 |
| Locus tag | QDY29_RS03965 | Protein ID | WP_000854821.1 |
| Coordinates | 809246..809623 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0D0LUA6 |
| Locus tag | QDY29_RS03970 | Protein ID | WP_001285613.1 |
| Coordinates | 809713..810081 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY29_RS03930 (804328) | 804328..804927 | + | 600 | WP_001255040.1 | type II secretion system minor pseudopilin GspJ | - |
| QDY29_RS03935 (804930) | 804930..805907 | + | 978 | WP_000633220.1 | type II secretion system minor pseudopilin GspK | - |
| QDY29_RS03940 (805924) | 805924..807081 | + | 1158 | Protein_773 | type II secretion system protein GspL | - |
| QDY29_RS03945 (807083) | 807083..807619 | + | 537 | WP_000942786.1 | GspM family type II secretion system protein YghD | - |
| QDY29_RS03950 (807900) | 807900..808742 | - | 843 | WP_001280493.1 | DUF4942 domain-containing protein | - |
| QDY29_RS03955 (808827) | 808827..809024 | - | 198 | WP_085949090.1 | DUF957 domain-containing protein | - |
| QDY29_RS03960 (809052) | 809052..809249 | - | 198 | Protein_777 | DUF5983 family protein | - |
| QDY29_RS03965 (809246) | 809246..809623 | - | 378 | WP_000854821.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QDY29_RS03970 (809713) | 809713..810081 | - | 369 | WP_001285613.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QDY29_RS03975 (810161) | 810161..810382 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| QDY29_RS03980 (810469) | 810469..810945 | - | 477 | WP_001384108.1 | RadC family protein | - |
| QDY29_RS03985 (810961) | 810961..811443 | - | 483 | WP_000206657.1 | antirestriction protein | - |
| QDY29_RS03990 (811535) | 811535..812353 | - | 819 | WP_042634191.1 | DUF932 domain-containing protein | - |
| QDY29_RS03995 (812443) | 812443..812676 | - | 234 | WP_001117568.1 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13930.95 Da Isoelectric Point: 8.5163
>T277930 WP_000854821.1 NZ_CP122816:c809623-809246 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13636.42 Da Isoelectric Point: 6.0618
>AT277930 WP_001285613.1 NZ_CP122816:c810081-809713 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQTFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQTFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7W4PV54 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0D0LUA6 |