Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 1056..1657 | Replicon | plasmid unnamed8 |
Accession | NZ_CP122809 | ||
Organism | Escherichia coli strain ETEC1734 |
Toxin (Protein)
Gene name | doc | Uniprot ID | A0A731GHK2 |
Locus tag | QDX84_RS28100 | Protein ID | WP_001216038.1 |
Coordinates | 1277..1657 (+) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | QDX84_RS28095 | Protein ID | WP_001190712.1 |
Coordinates | 1056..1277 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX84_RS28085 (QDX84_28085) | 1..390 | + | 390 | WP_022630896.1 | S24 family peptidase | - |
QDX84_RS28090 (QDX84_28090) | 525..947 | + | 423 | WP_000098854.1 | hypothetical protein | - |
QDX84_RS28095 (QDX84_28095) | 1056..1277 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QDX84_RS28100 (QDX84_28100) | 1277..1657 | + | 381 | WP_001216038.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
QDX84_RS28105 (QDX84_28105) | 1662..1859 | + | 198 | WP_000113017.1 | hypothetical protein | - |
QDX84_RS28110 (QDX84_28110) | 1892..2668 | - | 777 | WP_282835463.1 | hypothetical protein | - |
QDX84_RS28115 (QDX84_28115) | 2675..3352 | - | 678 | WP_001061873.1 | DUF2829 domain-containing protein | - |
QDX84_RS28120 (QDX84_28120) | 3367..3861 | - | 495 | WP_074525592.1 | dUTP diphosphatase | - |
QDX84_RS28125 (QDX84_28125) | 3858..4322 | - | 465 | WP_282835462.1 | hypothetical protein | - |
QDX84_RS28130 (QDX84_28130) | 4319..4663 | - | 345 | WP_001191776.1 | hypothetical protein | - |
QDX84_RS28135 (QDX84_28135) | 4737..5765 | - | 1029 | WP_001292231.1 | tyrosine-type recombinase/integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..90361 | 90361 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13574.27 Da Isoelectric Point: 5.1514
>T277924 WP_001216038.1 NZ_CP122809:1277-1657 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEISDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEISDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A731GHK2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |