Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 50873..51432 Replicon plasmid unnamed6
Accession NZ_CP122807
Organism Escherichia coli strain ETEC1734

Toxin (Protein)


Gene name relE Uniprot ID S1PMX5
Locus tag QDX84_RS27790 Protein ID WP_000421257.1
Coordinates 51157..51432 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C1J8K5
Locus tag QDX84_RS27785 Protein ID WP_001178089.1
Coordinates 50873..51157 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX84_RS27755 (46645) 46645..47235 + 591 WP_012817838.1 DUF2726 domain-containing protein -
QDX84_RS27760 (47390) 47390..47854 + 465 WP_000872610.1 hypothetical protein -
QDX84_RS27765 (48111) 48111..48260 + 150 WP_001378818.1 Hok/Gef family protein -
QDX84_RS27770 (48544) 48544..48792 + 249 WP_000083839.1 replication regulatory protein RepA -
QDX84_RS27775 (49036) 49036..49110 + 75 WP_001365705.1 RepA leader peptide Tap -
QDX84_RS27780 (49103) 49103..49960 + 858 WP_012817826.1 incFII family plasmid replication initiator RepA -
QDX84_RS27785 (50873) 50873..51157 + 285 WP_001178089.1 ribbon-helix-helix domain-containing protein Antitoxin
QDX84_RS27790 (51157) 51157..51432 + 276 WP_000421257.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QDX84_RS27795 (51715) 51715..52902 - 1188 WP_000937591.1 IS91 family transposase -
QDX84_RS27800 (52902) 52902..53267 - 366 WP_000091308.1 hypothetical protein -
QDX84_RS27805 (53352) 53352..53546 + 195 Protein_65 carbohydrate transporter -
QDX84_RS27810 (53562) 53562..53732 + 171 WP_162779668.1 hypothetical protein -
QDX84_RS27815 (53763) 53763..54342 + 580 Protein_67 transposase -
QDX84_RS27820 (54646) 54646..55854 - 1209 WP_000198533.1 IS91 family transposase -
QDX84_RS27825 (55835) 55835..56107 - 273 WP_000019163.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - estIa / hlyD / hlyB / hlyB / hlyA / hlyC 1..98226 98226


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 9.9324

>T277923 WP_000421257.1 NZ_CP122807:51157-51432 [Escherichia coli]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10456.86 Da        Isoelectric Point: 5.6558

>AT277923 WP_001178089.1 NZ_CP122807:50873-51157 [Escherichia coli]
IQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PMX5

Antitoxin

Source ID Structure
AlphaFold DB A0A731IHA8

References