Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 14803..15350 Replicon plasmid unnamed6
Accession NZ_CP122807
Organism Escherichia coli strain ETEC1734

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag QDX84_RS27575 Protein ID WP_001384452.1
Coordinates 15072..15350 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID E1QMW3
Locus tag QDX84_RS27570 Protein ID WP_000079941.1
Coordinates 14803..15072 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX84_RS27540 (9977) 9977..10435 - 459 Protein_12 transposase -
QDX84_RS27545 (10513) 10513..10662 - 150 Protein_13 transposase -
QDX84_RS27550 (11170) 11170..11388 + 219 WP_001353651.1 heat-stable enterotoxin ST-I group a -
QDX84_RS27560 (12972) 12972..13364 - 393 Protein_16 IS21-like element IS21 family helper ATPase IstB -
QDX84_RS27565 (13364) 13364..14536 - 1173 WP_282835500.1 IS21-like element IS21 family transposase -
QDX84_RS27570 (14803) 14803..15072 + 270 WP_000079941.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
QDX84_RS27575 (15072) 15072..15350 + 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
QDX84_RS27580 (15659) 15659..16801 + 1143 WP_158649904.1 YiiX/YebB-like N1pC/P60 family cysteine hydrolase -
QDX84_RS27585 (16774) 16774..16878 + 105 Protein_21 hypothetical protein -
QDX84_RS27590 (16890) 16890..17801 + 912 WP_024244186.1 toll/interleukin-1 receptor domain-containing protein -
QDX84_RS27595 (17943) 17943..18337 - 395 Protein_23 plasmid partitioning/stability family protein -
QDX84_RS27600 (18337) 18337..19296 - 960 WP_000921958.1 plasmid segregation protein ParM -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - estIa / hlyD / hlyB / hlyB / hlyA / hlyC 1..98226 98226


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T277919 WP_001384452.1 NZ_CP122807:15072-15350 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10252.58 Da        Isoelectric Point: 7.2057

>AT277919 WP_000079941.1 NZ_CP122807:14803-15072 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A629TXC5

References