Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/Xre(antitoxin)
Location 51932..52433 Replicon plasmid unnamed3
Accession NZ_CP122804
Organism Escherichia coli strain ETEC1734

Toxin (Protein)


Gene name TsxA Uniprot ID A0A6X6XTU7
Locus tag QDX84_RS26840 Protein ID WP_000702245.1
Coordinates 51932..52192 (+) Length 87 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID -
Locus tag QDX84_RS26845 Protein ID WP_000931278.1
Coordinates 52182..52433 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX84_RS26805 (47939) 47939..48286 - 348 WP_000624618.1 IS66 family insertion sequence element accessory protein TnpB -
QDX84_RS26810 (48286) 48286..48936 - 651 WP_000993956.1 IS66-like element accessory protein TnpA -
QDX84_RS26815 (49024) 49024..49479 - 456 Protein_62 division plane positioning ATPase MipZ -
QDX84_RS26820 (50077) 50077..50406 + 330 WP_000855121.1 hypothetical protein -
QDX84_RS26825 (50985) 50985..51308 + 324 WP_000427402.1 hypothetical protein -
QDX84_RS26830 (51349) 51349..51558 + 210 WP_000866037.1 hypothetical protein -
QDX84_RS26835 (51656) 51656..51880 + 225 WP_000814383.1 hypothetical protein -
QDX84_RS26840 (51932) 51932..52192 + 261 WP_000702245.1 hypothetical protein Toxin
QDX84_RS26845 (52182) 52182..52433 + 252 WP_000931278.1 transcriptional regulator Antitoxin
QDX84_RS26850 (52982) 52982..53260 + 279 WP_000545937.1 hypothetical protein -
QDX84_RS26855 (53725) 53725..53973 + 249 WP_000513532.1 type II toxin-antitoxin system HicA family toxin -
QDX84_RS26860 (53970) 53970..54317 + 348 WP_000681609.1 type II toxin-antitoxin system HicB family antitoxin -
QDX84_RS26865 (54528) 54528..55736 - 1209 WP_000198533.1 IS91 family transposase -
QDX84_RS26870 (55717) 55717..55989 - 273 WP_000019163.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid aadA5 / sul2 - 1..79114 79114


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-37)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 9818.23 Da        Isoelectric Point: 9.5163

>T277914 WP_000702245.1 NZ_CP122804:51932-52192 [Escherichia coli]
MKIRKGDRQYYLNKEGDTFHLVKRVKTFSKSATLGKTKATVKTVADLVFHEEAFDTIDFASDGLRENDKEIVSMMIQEMS
EGKNAK

Download         Length: 261 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9420.81 Da        Isoelectric Point: 9.8120

>AT277914 WP_000931278.1 NZ_CP122804:52182-52433 [Escherichia coli]
MLNENTPENIKRLRQKIGLTQKECAEIFSMSPRTWRRKEEPVGTASGTALTPVEFKFLLLLAGEHPDYVLCKRNKKNSDS
GSN

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6X6XTU7

Antitoxin

Source ID Structure

References