Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3948120..3948738 | Replicon | chromosome |
| Accession | NZ_CP122801 | ||
| Organism | Escherichia coli strain ETEC1734 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QDX84_RS20005 | Protein ID | WP_001291435.1 |
| Coordinates | 3948520..3948738 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QDX84_RS20000 | Protein ID | WP_000344800.1 |
| Coordinates | 3948120..3948494 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX84_RS19990 (3943209) | 3943209..3944402 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QDX84_RS19995 (3944425) | 3944425..3947574 | + | 3150 | WP_085007940.1 | efflux RND transporter permease AcrB | - |
| QDX84_RS20000 (3948120) | 3948120..3948494 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QDX84_RS20005 (3948520) | 3948520..3948738 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QDX84_RS20010 (3948910) | 3948910..3949461 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| QDX84_RS20015 (3949577) | 3949577..3950047 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| QDX84_RS20020 (3950211) | 3950211..3951761 | + | 1551 | WP_282834882.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QDX84_RS20025 (3951803) | 3951803..3952156 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| QDX84_RS20035 (3952535) | 3952535..3952846 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| QDX84_RS20040 (3952877) | 3952877..3953449 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T277905 WP_001291435.1 NZ_CP122801:3948520-3948738 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT277905 WP_000344800.1 NZ_CP122801:3948120-3948494 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |