Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 36830..37352 Replicon plasmid unnamed4
Accession NZ_CP122772
Organism Escherichia coli strain ETEC1738

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag QDY55_RS30050 Protein ID WP_000220560.1
Coordinates 36830..37111 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag QDY55_RS30055 Protein ID WP_000121743.1
Coordinates 37101..37352 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY55_RS30015 (QDY55_30010) 32028..32291 - 264 WP_000063165.1 hypothetical protein -
QDY55_RS30020 (QDY55_30015) 32430..33842 - 1413 Protein_32 DNA topoisomerase -
QDY55_RS30025 (QDY55_30020) 33924..34289 + 366 WP_000124098.1 hypothetical protein -
QDY55_RS30030 (QDY55_30025) 34289..35476 + 1188 WP_000937614.1 IS91-like element IS91 family transposase -
QDY55_RS30035 (QDY55_30030) 35866..36081 - 216 WP_001180116.1 hypothetical protein -
QDY55_RS30040 (QDY55_30035) 36071..36316 - 246 WP_000356545.1 hypothetical protein -
QDY55_RS30045 (QDY55_30040) 36361..36684 - 324 WP_001181907.1 hypothetical protein -
QDY55_RS30050 (QDY55_30045) 36830..37111 - 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QDY55_RS30055 (QDY55_30050) 37101..37352 - 252 WP_000121743.1 plasmid stabilization protein Antitoxin
QDY55_RS30060 (QDY55_30055) 38586..39422 + 837 WP_001050931.1 RepB family plasmid replication initiator protein -
QDY55_RS30065 (QDY55_30060) 39462..39908 + 447 WP_000057426.1 hypothetical protein -
QDY55_RS30070 (QDY55_30065) 40045..40401 + 357 WP_000456533.1 DNA distortion polypeptide 3 -
QDY55_RS30075 (QDY55_30070) 40398..41375 - 978 WP_001269910.1 hypothetical protein -
QDY55_RS30080 (QDY55_30075) 41400..41681 - 282 WP_001185482.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - hlyD / hlyB / hlyA / hlyC 1..76285 76285
- flank IS/Tn - - 34289..35476 1187


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T277892 WP_000220560.1 NZ_CP122772:c37111-36830 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT277892 WP_000121743.1 NZ_CP122772:c37352-37101 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References