Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 26805..27364 Replicon plasmid unnamed4
Accession NZ_CP122772
Organism Escherichia coli strain ETEC1738

Toxin (Protein)


Gene name relE Uniprot ID S1PMX5
Locus tag QDY55_RS29985 Protein ID WP_000421257.1
Coordinates 27089..27364 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C1J8K5
Locus tag QDY55_RS29980 Protein ID WP_001178089.1
Coordinates 26805..27089 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY55_RS29950 (QDY55_29945) 22484..22768 + 285 WP_096216116.1 hypothetical protein -
QDY55_RS29955 (QDY55_29950) 22874..23869 + 996 WP_000118344.1 hypothetical protein -
QDY55_RS29960 (QDY55_29955) 23940..24068 + 129 Protein_20 Hok/Gef family protein -
QDY55_RS29965 (QDY55_29960) 24313..24573 + 261 WP_005768671.1 replication regulatory protein RepA -
QDY55_RS29970 (QDY55_29965) 24801..24875 + 75 WP_064716759.1 RepA leader peptide Tap -
QDY55_RS29975 (QDY55_29970) 24868..25890 + 1023 WP_047628493.1 plasmid replication initiator RepA -
QDY55_RS29980 (QDY55_29975) 26805..27089 + 285 WP_001178089.1 ribbon-helix-helix domain-containing protein Antitoxin
QDY55_RS29985 (QDY55_29980) 27089..27364 + 276 WP_000421257.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QDY55_RS29990 (QDY55_29985) 27648..28835 - 1188 WP_000937614.1 IS91-like element IS91 family transposase -
QDY55_RS29995 (QDY55_29990) 28835..29200 - 366 WP_000124098.1 hypothetical protein -
QDY55_RS30000 (QDY55_29995) 29623..30096 - 474 WP_001122138.1 type II toxin-antitoxin system PemK/MazF family toxin -
QDY55_RS30005 (QDY55_30000) 30886..30981 - 96 WP_000609147.1 DinQ-like type I toxin DqlB -
QDY55_RS30010 (QDY55_30005) 31434..31856 - 423 WP_001398192.1 hypothetical protein -
QDY55_RS30015 (QDY55_30010) 32028..32291 - 264 WP_000063165.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - hlyD / hlyB / hlyA / hlyC 1..76285 76285
- flank IS/Tn - - 27648..28835 1187


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 9.9324

>T277891 WP_000421257.1 NZ_CP122772:27089-27364 [Escherichia coli]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10456.86 Da        Isoelectric Point: 5.6558

>AT277891 WP_001178089.1 NZ_CP122772:26805-27089 [Escherichia coli]
IQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PMX5

Antitoxin

Source ID Structure
AlphaFold DB A0A731IHA8

References