Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 4958733..4959328 | Replicon | chromosome |
| Accession | NZ_CP122768 | ||
| Organism | Escherichia coli strain ETEC1738 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | - |
| Locus tag | QDY55_RS24805 | Protein ID | WP_064225787.1 |
| Coordinates | 4958733..4959083 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | L4JJX7 |
| Locus tag | QDY55_RS24810 | Protein ID | WP_001223213.1 |
| Coordinates | 4959077..4959328 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY55_RS24785 (4954187) | 4954187..4955209 | - | 1023 | WP_001298067.1 | ABC transporter permease | - |
| QDY55_RS24790 (4955223) | 4955223..4956725 | - | 1503 | WP_064225788.1 | sugar ABC transporter ATP-binding protein | - |
| QDY55_RS24795 (4956858) | 4956858..4957814 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| QDY55_RS24800 (4958124) | 4958124..4958654 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
| QDY55_RS24805 (4958733) | 4958733..4959083 | - | 351 | WP_064225787.1 | endoribonuclease toxin ChpB | Toxin |
| QDY55_RS24810 (4959077) | 4959077..4959328 | - | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| QDY55_RS24815 (4959540) | 4959540..4959881 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| QDY55_RS24820 (4959884) | 4959884..4963663 | - | 3780 | WP_149448756.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12481.46 Da Isoelectric Point: 6.2206
>T277881 WP_064225787.1 NZ_CP122768:c4959083-4958733 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYVGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYVGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|