Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4403620..4404455 | Replicon | chromosome |
| Accession | NZ_CP122768 | ||
| Organism | Escherichia coli strain ETEC1738 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A7W4PV54 |
| Locus tag | QDY55_RS22155 | Protein ID | WP_000854821.1 |
| Coordinates | 4403620..4403997 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7MK11 |
| Locus tag | QDY55_RS22160 | Protein ID | WP_001285610.1 |
| Coordinates | 4404087..4404455 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY55_RS22125 (4398833) | 4398833..4399717 | + | 885 | WP_001119037.1 | LysR family transcriptional regulator | - |
| QDY55_RS22130 (4400287) | 4400287..4400517 | + | 231 | Protein_4343 | LysR substrate-binding domain-containing protein | - |
| QDY55_RS22135 (4400856) | 4400856..4402175 | + | 1320 | WP_064226131.1 | site-specific integrase | - |
| QDY55_RS22140 (4402268) | 4402268..4403116 | - | 849 | WP_064226132.1 | DUF4942 domain-containing protein | - |
| QDY55_RS22145 (4403201) | 4403201..4403398 | - | 198 | WP_089075429.1 | DUF957 domain-containing protein | - |
| QDY55_RS22150 (4403426) | 4403426..4403623 | - | 198 | Protein_4347 | DUF5983 family protein | - |
| QDY55_RS22155 (4403620) | 4403620..4403997 | - | 378 | WP_000854821.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QDY55_RS22160 (4404087) | 4404087..4404455 | - | 369 | WP_001285610.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QDY55_RS22165 (4404535) | 4404535..4404756 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| QDY55_RS22170 (4404843) | 4404843..4405319 | - | 477 | WP_001186745.1 | RadC family protein | - |
| QDY55_RS22175 (4405335) | 4405335..4405820 | - | 486 | WP_024214936.1 | antirestriction protein | - |
| QDY55_RS22180 (4405912) | 4405912..4406730 | - | 819 | WP_001234397.1 | DUF932 domain-containing protein | - |
| QDY55_RS22185 (4406876) | 4406876..4407334 | - | 459 | WP_000502112.1 | IS200/IS605 family transposase | - |
| QDY55_RS22190 (4407531) | 4407531..4407764 | - | 234 | WP_001117566.1 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 4406876..4407334 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13930.95 Da Isoelectric Point: 8.5163
>T277876 WP_000854821.1 NZ_CP122768:c4403997-4403620 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13606.39 Da Isoelectric Point: 6.0618
>AT277876 WP_001285610.1 NZ_CP122768:c4404455-4404087 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|