Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
| Location | 3692260..3692965 | Replicon | chromosome |
| Accession | NZ_CP122768 | ||
| Organism | Escherichia coli strain ETEC1738 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1F406 |
| Locus tag | QDY55_RS18700 | Protein ID | WP_000539521.1 |
| Coordinates | 3692260..3692646 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QDY55_RS18705 | Protein ID | WP_001280945.1 |
| Coordinates | 3692636..3692965 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY55_RS18680 (3688264) | 3688264..3688890 | + | 627 | WP_001314584.1 | glutathione S-transferase GstB | - |
| QDY55_RS18685 (3688887) | 3688887..3690002 | - | 1116 | WP_000555051.1 | aldose sugar dehydrogenase YliI | - |
| QDY55_RS18690 (3690113) | 3690113..3690496 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
| QDY55_RS18695 (3690709) | 3690709..3692034 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| QDY55_RS18700 (3692260) | 3692260..3692646 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QDY55_RS18705 (3692636) | 3692636..3692965 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
| QDY55_RS18710 (3693035) | 3693035..3694363 | - | 1329 | WP_064225610.1 | GGDEF domain-containing protein | - |
| QDY55_RS18715 (3694371) | 3694371..3696719 | - | 2349 | WP_064225624.1 | EAL domain-containing protein | - |
| QDY55_RS18720 (3696897) | 3696897..3697808 | - | 912 | WP_001236044.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T277874 WP_000539521.1 NZ_CP122768:3692260-3692646 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|