Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3549963..3550797 Replicon chromosome
Accession NZ_CP122768
Organism Escherichia coli strain ETEC1738

Toxin (Protein)


Gene name yeeV Uniprot ID W0S379
Locus tag QDY55_RS17905 Protein ID WP_000854808.1
Coordinates 3549963..3550340 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID W0S4A5
Locus tag QDY55_RS17910 Protein ID WP_001285114.1
Coordinates 3550429..3550797 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY55_RS17875 (3546644) 3546644..3547348 + 705 WP_001241678.1 leucyl/phenylalanyl-tRNA--protein transferase -
QDY55_RS17880 (3547633) 3547633..3547851 + 219 WP_001040187.1 translation initiation factor IF-1 -
QDY55_RS17890 (3548342) 3548342..3549184 - 843 WP_001280436.1 DUF4942 domain-containing protein -
QDY55_RS17895 (3549269) 3549269..3549466 - 198 WP_000839248.1 DUF957 domain-containing protein -
QDY55_RS17900 (3549478) 3549478..3549966 - 489 WP_000761657.1 DUF5983 family protein -
QDY55_RS17905 (3549963) 3549963..3550340 - 378 WP_000854808.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QDY55_RS17910 (3550429) 3550429..3550797 - 369 WP_001285114.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QDY55_RS17915 (3550847) 3550847..3551494 - 648 WP_000094919.1 hypothetical protein -
QDY55_RS17920 (3551513) 3551513..3551734 - 222 WP_000692345.1 DUF987 domain-containing protein -
QDY55_RS17925 (3551803) 3551803..3552279 - 477 WP_001186747.1 RadC family protein -
QDY55_RS17930 (3552295) 3552295..3552780 - 486 WP_000214416.1 antirestriction protein -
QDY55_RS17935 (3552872) 3552872..3553690 - 819 WP_001234743.1 DUF932 domain-containing protein -
QDY55_RS17940 (3553783) 3553783..3553961 + 179 Protein_3524 hypothetical protein -
QDY55_RS17945 (3554101) 3554101..3554514 - 414 WP_000789535.1 hypothetical protein -
QDY55_RS17950 (3554784) 3554784..3555323 - 540 WP_001104020.1 DUF4339 domain-containing protein -
QDY55_RS17955 (3555448) 3555448..3555621 - 174 WP_001370911.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13909.93 Da        Isoelectric Point: 7.9085

>T277873 WP_000854808.1 NZ_CP122768:c3550340-3549963 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13767.60 Da        Isoelectric Point: 6.9460

>AT277873 WP_001285114.1 NZ_CP122768:c3550797-3550429 [Escherichia coli]
VSDSLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQALPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCKADTLSSCGYVYLAVYPTPKMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB W0S379

Antitoxin

Source ID Structure
AlphaFold DB W0S4A5

References