Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2056605..2057373 Replicon chromosome
Accession NZ_CP122768
Organism Escherichia coli strain ETEC1738

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QDY55_RS10005 Protein ID WP_000854814.1
Coordinates 2056605..2056979 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A3W4SUB1
Locus tag QDY55_RS10010 Protein ID WP_044863316.1
Coordinates 2057068..2057373 (-) Length 102 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY55_RS09965 (2052002) 2052002..2053168 + 1167 WP_001464461.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
QDY55_RS09970 (2053287) 2053287..2053760 + 474 WP_001105393.1 DNA gyrase inhibitor SbmC -
QDY55_RS09975 (2053957) 2053957..2055015 + 1059 WP_001200891.1 FUSC family protein -
QDY55_RS09980 (2055187) 2055187..2055516 + 330 WP_000450409.1 DUF496 family protein -
QDY55_RS09985 (2055617) 2055617..2055751 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
QDY55_RS09990 (2055871) 2055871..2055999 + 129 Protein_1958 transposase domain-containing protein -
QDY55_RS09995 (2056288) 2056288..2056368 - 81 Protein_1959 hypothetical protein -
QDY55_RS10000 (2056414) 2056414..2056608 - 195 WP_000988600.1 DUF5983 family protein -
QDY55_RS10005 (2056605) 2056605..2056979 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QDY55_RS10010 (2057068) 2057068..2057373 - 306 WP_044863316.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QDY55_RS10015 (2057510) 2057510..2057731 - 222 WP_000692323.1 DUF987 domain-containing protein -
QDY55_RS10020 (2057794) 2057794..2058270 - 477 WP_001186726.1 RadC family protein -
QDY55_RS10025 (2058286) 2058286..2058765 - 480 WP_096969732.1 antirestriction protein -
QDY55_RS10030 (2058847) 2058847..2059665 - 819 WP_001234631.1 DUF932 domain-containing protein -
QDY55_RS10035 (2059765) 2059765..2059998 - 234 WP_063610949.1 DUF905 family protein -
QDY55_RS10040 (2060077) 2060077..2060532 - 456 WP_000581504.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(2-96)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T277867 WP_000854814.1 NZ_CP122768:c2056979-2056605 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 102 a.a.        Molecular weight: 11250.00 Da        Isoelectric Point: 7.2621

>AT277867 WP_044863316.1 NZ_CP122768:c2057373-2057068 [Escherichia coli]
MPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSGELNPRHQHTVTLYAKGLTCKA
DTLSSCGYVYLAVYPTPEMKN

Download         Length: 306 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A3W4SUB1

References