Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 989140..989794 | Replicon | chromosome |
Accession | NZ_CP122768 | ||
Organism | Escherichia coli strain ETEC1738 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | QDY55_RS04800 | Protein ID | WP_000244781.1 |
Coordinates | 989387..989794 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | QDY55_RS04795 | Protein ID | WP_000354046.1 |
Coordinates | 989140..989406 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDY55_RS04775 (985228) | 985228..986661 | - | 1434 | WP_048969496.1 | 6-phospho-beta-glucosidase BglA | - |
QDY55_RS04780 (986706) | 986706..987017 | + | 312 | WP_001182951.1 | N(4)-acetylcytidine aminohydrolase | - |
QDY55_RS04785 (987181) | 987181..987840 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
QDY55_RS04790 (987917) | 987917..988897 | - | 981 | WP_001587401.1 | tRNA-modifying protein YgfZ | - |
QDY55_RS04795 (989140) | 989140..989406 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
QDY55_RS04800 (989387) | 989387..989794 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
QDY55_RS04805 (989834) | 989834..990355 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
QDY55_RS04810 (990467) | 990467..991363 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
QDY55_RS04815 (991388) | 991388..992098 | + | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QDY55_RS04820 (992104) | 992104..993837 | + | 1734 | WP_000813175.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T277864 WP_000244781.1 NZ_CP122768:989387-989794 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|