Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 887610..888445 | Replicon | chromosome |
| Accession | NZ_CP122768 | ||
| Organism | Escherichia coli strain ETEC1738 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1EZ92 |
| Locus tag | QDY55_RS04300 | Protein ID | WP_000854726.1 |
| Coordinates | 887610..887987 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | QDY55_RS04305 | Protein ID | WP_064226358.1 |
| Coordinates | 888077..888445 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY55_RS04270 (883018) | 883018..883995 | + | 978 | WP_149449088.1 | type II secretion system minor pseudopilin GspK | - |
| QDY55_RS04275 (883992) | 883992..885170 | + | 1179 | WP_089592171.1 | type II secretion system protein GspL | - |
| QDY55_RS04280 (885172) | 885172..885708 | + | 537 | WP_000942793.1 | GspM family type II secretion system protein YghD | - |
| QDY55_RS04285 (885989) | 885989..886831 | - | 843 | WP_077737641.1 | DUF4942 domain-containing protein | - |
| QDY55_RS04290 (886916) | 886916..887113 | - | 198 | WP_000839269.1 | DUF957 domain-containing protein | - |
| QDY55_RS04295 (887125) | 887125..887613 | - | 489 | WP_063100845.1 | DUF5983 family protein | - |
| QDY55_RS04300 (887610) | 887610..887987 | - | 378 | WP_000854726.1 | TA system toxin CbtA family protein | Toxin |
| QDY55_RS04305 (888077) | 888077..888445 | - | 369 | WP_064226358.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QDY55_RS04310 (888524) | 888524..888745 | - | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| QDY55_RS04315 (888814) | 888814..889290 | - | 477 | WP_064226357.1 | RadC family protein | - |
| QDY55_RS04320 (889305) | 889305..889790 | - | 486 | WP_042631074.1 | antirestriction protein | - |
| QDY55_RS04325 (889881) | 889881..890699 | - | 819 | WP_063100855.1 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14164.10 Da Isoelectric Point: 7.8045
>T277863 WP_000854726.1 NZ_CP122768:c887987-887610 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13652.36 Da Isoelectric Point: 6.4761
>AT277863 WP_064226358.1 NZ_CP122768:c888445-888077 [Escherichia coli]
VSDTLPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLTDRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPHHQHTVTLYAKGLTCEADTFGSCGYVYLAVYPTPETKK
VSDTLPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLTDRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPHHQHTVTLYAKGLTCEADTFGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|