Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 385204..385799 Replicon chromosome
Accession NZ_CP122768
Organism Escherichia coli strain ETEC1738

Toxin (Protein)


Gene name doc Uniprot ID D6JG31
Locus tag QDY55_RS01795 Protein ID WP_000155159.1
Coordinates 385422..385799 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID D6JG32
Locus tag QDY55_RS01790 Protein ID WP_000557315.1
Coordinates 385204..385425 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY55_RS01765 (380280) 380280..381389 + 1110 WP_001469403.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
QDY55_RS01770 (381437) 381437..382363 + 927 WP_001295111.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QDY55_RS01775 (382360) 382360..383637 + 1278 WP_025210937.1 branched chain amino acid ABC transporter permease LivM -
QDY55_RS01780 (383634) 383634..384401 + 768 WP_000082101.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QDY55_RS01785 (384403) 384403..385116 + 714 WP_000416895.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QDY55_RS01790 (385204) 385204..385425 + 222 WP_000557315.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QDY55_RS01795 (385422) 385422..385799 + 378 WP_000155159.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QDY55_RS01800 (386008) 386008..387324 + 1317 WP_000803190.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QDY55_RS01805 (387422) 387422..388309 + 888 WP_064225379.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QDY55_RS01810 (388306) 388306..389151 + 846 WP_000572183.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QDY55_RS01815 (389153) 389153..390223 + 1071 WP_000907821.1 sn-glycerol 3-phosphate ABC transporter ATP binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 375081..390963 15882


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(27-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-53)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13964.25 Da        Isoelectric Point: 6.7263

>T277861 WP_000155159.1 NZ_CP122768:385422-385799 [Escherichia coli]
MTIQFISAEEIIYFHDKLLSVTPGVTGMSDPGRAEALLYRVLNKYEYEGVSDLWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILAANPEFVELTVDVAAGKVSLEDIVTRLRQRGT

Download         Length: 378 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8103.24 Da        Isoelectric Point: 6.2168

>AT277861 WP_000557315.1 NZ_CP122768:385204-385425 [Escherichia coli]
MHTMNYSEARQNLALVLETAATGTPVTITRRGHKAAVIISAEEFERYQKAKLDAEFDAIMAIHGSEIKELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB D6JG31

Antitoxin

Source ID Structure
AlphaFold DB D6JG32

References