Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 218788..219400 | Replicon | chromosome |
Accession | NZ_CP122768 | ||
Organism | Escherichia coli strain ETEC1738 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | U9YXE2 |
Locus tag | QDY55_RS01040 | Protein ID | WP_000833473.1 |
Coordinates | 218788..218973 (+) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | L4IWR9 |
Locus tag | QDY55_RS01045 | Protein ID | WP_000499744.1 |
Coordinates | 218990..219400 (+) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDY55_RS01025 (214305) | 214305..215456 | + | 1152 | WP_000741501.1 | L-threonine dehydrogenase | - |
QDY55_RS01030 (215657) | 215657..217195 | + | 1539 | WP_000183978.1 | aldehyde dehydrogenase AldB | - |
QDY55_RS01035 (217236) | 217236..218315 | - | 1080 | Protein_205 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
QDY55_RS01040 (218788) | 218788..218973 | + | 186 | WP_000833473.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
QDY55_RS01045 (218990) | 218990..219400 | + | 411 | WP_000499744.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
QDY55_RS01050 (219472) | 219472..221436 | - | 1965 | WP_064226479.1 | glycoside hydrolase family 127 protein | - |
QDY55_RS01055 (221447) | 221447..222847 | - | 1401 | WP_149448759.1 | MFS transporter | - |
QDY55_RS01060 (223073) | 223073..223888 | + | 816 | WP_000891823.1 | AraC family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6800.89 Da Isoelectric Point: 11.7053
>T277859 WP_000833473.1 NZ_CP122768:218788-218973 [Escherichia coli]
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15241.15 Da Isoelectric Point: 4.5486
>AT277859 WP_000499744.1 NZ_CP122768:218990-219400 [Escherichia coli]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|