Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 72846..73644 | Replicon | chromosome |
| Accession | NZ_CP122768 | ||
| Organism | Escherichia coli strain ETEC1738 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | U9XMP3 |
| Locus tag | QDY55_RS00310 | Protein ID | WP_000854735.1 |
| Coordinates | 72846..73223 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A067H947 |
| Locus tag | QDY55_RS00315 | Protein ID | WP_001285415.1 |
| Coordinates | 73270..73644 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY55_RS00280 (68193) | 68193..69116 | - | 924 | WP_000535949.1 | carboxylate/amino acid/amine transporter | - |
| QDY55_RS00285 (69227) | 69227..70411 | - | 1185 | WP_001172864.1 | sugar efflux transporter | - |
| QDY55_RS00290 (70841) | 70841..70969 | - | 129 | Protein_57 | RhuM family protein | - |
| QDY55_RS00295 (71207) | 71207..72049 | - | 843 | WP_000036706.1 | DUF4942 domain-containing protein | - |
| QDY55_RS00300 (72146) | 72146..72343 | - | 198 | WP_000839266.1 | DUF957 domain-containing protein | - |
| QDY55_RS00305 (72361) | 72361..72849 | - | 489 | WP_000761680.1 | DUF5983 family protein | - |
| QDY55_RS00310 (72846) | 72846..73223 | - | 378 | WP_000854735.1 | TA system toxin CbtA family protein | Toxin |
| QDY55_RS00315 (73270) | 73270..73644 | - | 375 | WP_001285415.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QDY55_RS00320 (73724) | 73724..73945 | - | 222 | WP_000692309.1 | DUF987 domain-containing protein | - |
| QDY55_RS00325 (74008) | 74008..74484 | - | 477 | WP_001366855.1 | RadC family protein | - |
| QDY55_RS00330 (74500) | 74500..74979 | - | 480 | WP_042630954.1 | antirestriction protein | - |
| QDY55_RS00335 (75061) | 75061..75879 | - | 819 | WP_001175149.1 | DUF932 domain-containing protein | - |
| QDY55_RS00340 (75969) | 75969..76202 | - | 234 | WP_001278287.1 | DUF905 family protein | - |
| QDY55_RS00345 (76208) | 76208..76885 | - | 678 | WP_001097301.1 | hypothetical protein | - |
| QDY55_RS00350 (77033) | 77033..77713 | - | 681 | WP_001282919.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | sul1 / qacE / ant(3'')-Ia / dfrA1 / catA1 | - | 61505..139475 | 77970 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14061.07 Da Isoelectric Point: 8.2904
>T277858 WP_000854735.1 NZ_CP122768:c73223-72846 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13663.32 Da Isoelectric Point: 5.8640
>AT277858 WP_001285415.1 NZ_CP122768:c73644-73270 [Escherichia coli]
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | U9XMP3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A067H947 |