Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 26415..26937 Replicon plasmid unnamed7
Accession NZ_CP122765
Organism Escherichia coli strain ETEC1739

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag QDW95_RS25300 Protein ID WP_000220560.1
Coordinates 26656..26937 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag QDW95_RS25295 Protein ID WP_000121743.1
Coordinates 26415..26666 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW95_RS25265 (QDW95_25265) 21495..22157 + 663 WP_000516402.1 division plane positioning ATPase MipZ -
QDW95_RS25270 (QDW95_25270) 22255..22536 + 282 WP_001185482.1 hypothetical protein -
QDW95_RS25275 (QDW95_25275) 22561..23538 + 978 WP_024127745.1 hypothetical protein -
QDW95_RS25280 (QDW95_25280) 23535..23891 - 357 WP_052921318.1 DNA distortion polypeptide 3 -
QDW95_RS25285 (QDW95_25285) 24028..24474 - 447 WP_001074386.1 hypothetical protein -
QDW95_RS25290 (QDW95_25290) 24499..25353 - 855 WP_001239324.1 replication initiation protein -
QDW95_RS25295 (QDW95_25295) 26415..26666 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
QDW95_RS25300 (QDW95_25300) 26656..26937 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QDW95_RS25305 (QDW95_25305) 27083..27406 + 324 WP_001181903.1 hypothetical protein -
QDW95_RS25310 (QDW95_25310) 27451..27696 + 246 WP_001550454.1 hypothetical protein -
QDW95_RS25315 (QDW95_25315) 27686..27901 + 216 WP_052921379.1 hypothetical protein -
QDW95_RS25320 (QDW95_25320) 27994..28323 + 330 WP_000866648.1 hypothetical protein -
QDW95_RS25325 (QDW95_25325) 28366..28545 + 180 WP_000439078.1 hypothetical protein -
QDW95_RS25330 (QDW95_25330) 28615..28764 + 150 WP_000003880.1 hypothetical protein -
QDW95_RS25335 (QDW95_25335) 28777..29049 + 273 WP_000160399.1 hypothetical protein -
QDW95_RS25340 (QDW95_25340) 29375..29920 + 546 WP_000757693.1 DNA distortion polypeptide 1 -
QDW95_RS25345 (QDW95_25345) 29923..31089 + 1167 WP_000539529.1 MobP1 family relaxase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid qnrS1 / blaTEM-1B - 1..47686 47686


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T277852 WP_000220560.1 NZ_CP122765:26656-26937 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT277852 WP_000121743.1 NZ_CP122765:26415-26666 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References