Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 35559..36202 Replicon plasmid unnamed4
Accession NZ_CP122762
Organism Escherichia coli strain ETEC1739

Toxin (Protein)


Gene name vagD Uniprot ID B1LRW4
Locus tag QDW95_RS24320 Protein ID WP_001044768.1
Coordinates 35786..36202 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D2WFK3
Locus tag QDW95_RS24315 Protein ID WP_001261287.1
Coordinates 35559..35789 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW95_RS24280 (30844) 30844..32538 - 1695 WP_000105636.1 mercury(II) reductase -
QDW95_RS24285 (32590) 32590..33012 - 423 WP_001340589.1 organomercurial transporter MerC -
QDW95_RS24290 (33048) 33048..33323 - 276 WP_000732292.1 mercury resistance system periplasmic binding protein MerP -
QDW95_RS24295 (33337) 33337..33687 - 351 WP_001294663.1 mercuric transport protein MerT -
QDW95_RS24300 (33759) 33759..34193 + 435 WP_000429836.1 Hg(II)-responsive transcriptional regulator -
QDW95_RS24305 (34240) 34240..34944 - 705 WP_282836053.1 IS6-like element IS26 family transposase -
QDW95_RS24310 (34991) 34991..35263 - 273 WP_061602529.1 hypothetical protein -
QDW95_RS24315 (35559) 35559..35789 + 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QDW95_RS24320 (35786) 35786..36202 + 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin Toxin
QDW95_RS24325 (36364) 36364..38502 - 2139 WP_000350638.1 AAA family ATPase -
QDW95_RS24330 (38856) 38856..39113 + 258 WP_000343085.1 hypothetical protein -
QDW95_RS24335 (39113) 39113..39469 + 357 Protein_45 hypothetical protein -
QDW95_RS24340 (39518) 39518..40222 - 705 WP_001067858.1 IS6-like element IS26 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid tet(A) / dfrA12 / aadA2 / cmlA1 / sul3 / mef(B) / aph(3')-Ia / oqxA / oqxB - 1..95417 95417
- inside IScluster/Tn oqxA / oqxB - 34240..46253 12013


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15197.66 Da        Isoelectric Point: 7.7805

>T277851 WP_001044768.1 NZ_CP122762:35786-36202 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8815.90 Da        Isoelectric Point: 4.3775

>AT277851 WP_001261287.1 NZ_CP122762:35559-35789 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLEYEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A606Q844

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9QFC4

References