Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/ElaA-DUF1778 |
Location | 97073..97876 | Replicon | plasmid unnamed3 |
Accession | NZ_CP122761 | ||
Organism | Escherichia coli strain ETEC1739 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A0K3X5E3 |
Locus tag | QDW95_RS24035 | Protein ID | WP_000348884.1 |
Coordinates | 97346..97876 (+) | Length | 177 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | G3CAI7 |
Locus tag | QDW95_RS24030 | Protein ID | WP_001275013.1 |
Coordinates | 97073..97342 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW95_RS24005 (92478) | 92478..92738 | - | 261 | Protein_101 | transposase | - |
QDW95_RS24010 (92754) | 92754..94024 | + | 1271 | WP_169029802.1 | IS3-like element IS2 family transposase | - |
QDW95_RS24015 (93999) | 93999..94193 | + | 195 | WP_077881938.1 | hypothetical protein | - |
QDW95_RS24020 (94314) | 94314..95048 | + | 735 | WP_282836067.1 | tyrosine-type recombinase/integrase | - |
QDW95_RS24025 (95196) | 95196..96185 | - | 990 | WP_024201093.1 | RepB family plasmid replication initiator protein | - |
QDW95_RS24030 (97073) | 97073..97342 | + | 270 | WP_001275013.1 | DUF1778 domain-containing protein | Antitoxin |
QDW95_RS24035 (97346) | 97346..97876 | + | 531 | WP_000348884.1 | GNAT family N-acetyltransferase | Toxin |
QDW95_RS24040 (97877) | 97877..98094 | + | 218 | Protein_108 | transposase | - |
QDW95_RS24045 (98153) | 98153..98803 | - | 651 | Protein_109 | transposase zinc-binding domain-containing protein | - |
QDW95_RS24050 (98784) | 98784..99056 | - | 273 | WP_000019163.1 | hypothetical protein | - |
QDW95_RS24055 (99127) | 99127..99214 | - | 88 | Protein_111 | hypothetical protein | - |
QDW95_RS24060 (99242) | 99242..99457 | + | 216 | WP_001435544.1 | RepB family plasmid replication initiator protein | - |
QDW95_RS24065 (100305) | 100305..100937 | + | 633 | WP_000312330.1 | ParA family protein | - |
QDW95_RS24070 (100937) | 100937..101311 | + | 375 | WP_063078193.1 | hypothetical protein | - |
QDW95_RS24075 (101549) | 101549..102523 | + | 975 | WP_021534625.1 | plasmid segregation protein ParM | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | hlyD / hlyD / hlyB / hlyA / hlyC | 1..106236 | 106236 | |
- | inside | IScluster/Tn | - | - | 89023..98803 | 9780 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 177 a.a. Molecular weight: 20320.22 Da Isoelectric Point: 6.7486
>T277850 WP_000348884.1 NZ_CP122761:97346-97876 [Escherichia coli]
MDGLRIEIFSEEVEYQLSNFDCGEEYLNTFLTDHLQRQHSSKILRGYLLVTREDRPRVMGYYTLSGSCFEKILLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKEENCNSL
FYPTKSIEVLFEVNDE
MDGLRIEIFSEEVEYQLSNFDCGEEYLNTFLTDHLQRQHSSKILRGYLLVTREDRPRVMGYYTLSGSCFEKILLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKEENCNSL
FYPTKSIEVLFEVNDE
Download Length: 531 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K3X5E3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G3CAI7 |