Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 55622..56175 Replicon plasmid unnamed3
Accession NZ_CP122761
Organism Escherichia coli strain ETEC1739

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag QDW95_RS23835 Protein ID WP_096217460.1
Coordinates 55891..56175 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag QDW95_RS23830 Protein ID WP_069192543.1
Coordinates 55622..55891 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW95_RS23800 (51059) 51059..51268 + 210 WP_001297500.1 hypothetical protein -
QDW95_RS23805 (51680) 51680..52306 + 627 WP_000794191.1 NYN domain-containing protein -
QDW95_RS23810 (52458) 52458..53048 + 591 WP_001375082.1 DUF2726 domain-containing protein -
QDW95_RS23815 (53288) 53288..53536 + 249 WP_000083839.1 replication regulatory protein RepA -
QDW95_RS23820 (53781) 53781..53855 + 75 WP_001365705.1 RepA leader peptide Tap -
QDW95_RS23825 (53848) 53848..54705 + 858 WP_042634321.1 incFII family plasmid replication initiator RepA -
QDW95_RS23830 (55622) 55622..55891 + 270 WP_069192543.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
QDW95_RS23835 (55891) 55891..56175 + 285 WP_096217460.1 type II toxin-antitoxin system toxin YacB Toxin
QDW95_RS23840 (56142) 56142..56420 + 279 Protein_68 IS66 family insertion sequence element accessory protein TnpB -
QDW95_RS23845 (56440) 56440..58011 + 1572 WP_062873784.1 IS66-like element ISCro1 family transposase -
QDW95_RS23850 (58046) 58046..58375 - 330 Protein_70 oxidoreductase -
QDW95_RS23855 (58375) 58375..59335 - 961 Protein_71 IS3 family transposase -
QDW95_RS23860 (59723) 59723..59938 - 216 WP_015056453.1 heat-stable enterotoxin ST-II -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - hlyD / hlyD / hlyB / hlyA / hlyC 1..106236 106236
- inside IScluster/Tn - - 56115..81434 25319


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-84)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 11043.65 Da        Isoelectric Point: 9.4120

>T277848 WP_096217460.1 NZ_CP122761:55891-56175 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVTAWHQKFRTS

Download         Length: 285 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10224.53 Da        Isoelectric Point: 6.4681

>AT277848 WP_069192543.1 NZ_CP122761:55622-55891 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVEQQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References