Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2518856..2519494 | Replicon | chromosome |
Accession | NZ_CP122758 | ||
Organism | Escherichia coli strain ETEC1739 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | QDW95_RS12400 | Protein ID | WP_000813794.1 |
Coordinates | 2519318..2519494 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QDW95_RS12395 | Protein ID | WP_001270286.1 |
Coordinates | 2518856..2519272 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW95_RS12375 (2514008) | 2514008..2514949 | - | 942 | WP_087905458.1 | ABC transporter permease | - |
QDW95_RS12380 (2514950) | 2514950..2515963 | - | 1014 | WP_097740840.1 | ABC transporter ATP-binding protein | - |
QDW95_RS12385 (2515981) | 2515981..2517126 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
QDW95_RS12390 (2517371) | 2517371..2518777 | - | 1407 | WP_000760585.1 | PLP-dependent aminotransferase family protein | - |
QDW95_RS12395 (2518856) | 2518856..2519272 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QDW95_RS12400 (2519318) | 2519318..2519494 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QDW95_RS12405 (2519716) | 2519716..2519946 | + | 231 | WP_196010979.1 | YncJ family protein | - |
QDW95_RS12410 (2520038) | 2520038..2521999 | - | 1962 | WP_282868944.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QDW95_RS12415 (2522072) | 2522072..2522608 | - | 537 | WP_000429133.1 | DNA-binding transcriptional regulator SutR | - |
QDW95_RS12420 (2522700) | 2522700..2523875 | + | 1176 | WP_001236251.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2523915..2525180 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T277843 WP_000813794.1 NZ_CP122758:c2519494-2519318 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT277843 WP_001270286.1 NZ_CP122758:c2519272-2518856 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|