Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 695900..696735 | Replicon | chromosome |
Accession | NZ_CP122758 | ||
Organism | Escherichia coli strain ETEC1739 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A0J5ZPW7 |
Locus tag | QDW95_RS03400 | Protein ID | WP_000854722.1 |
Coordinates | 696358..696735 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A0K4A940 |
Locus tag | QDW95_RS03395 | Protein ID | WP_001285576.1 |
Coordinates | 695900..696268 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW95_RS03375 (693652) | 693652..694470 | + | 819 | WP_169029782.1 | DUF932 domain-containing protein | - |
QDW95_RS03380 (694562) | 694562..695044 | + | 483 | WP_169029783.1 | antirestriction protein | - |
QDW95_RS03385 (695060) | 695060..695536 | + | 477 | WP_053289735.1 | RadC family protein | - |
QDW95_RS03390 (695599) | 695599..695820 | + | 222 | WP_089570377.1 | DUF987 domain-containing protein | - |
QDW95_RS03395 (695900) | 695900..696268 | + | 369 | WP_001285576.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QDW95_RS03400 (696358) | 696358..696735 | + | 378 | WP_000854722.1 | TA system toxin CbtA family protein | Toxin |
QDW95_RS03405 (696732) | 696732..697220 | + | 489 | WP_000761669.1 | DUF5983 family protein | - |
QDW95_RS03410 (697240) | 697240..697437 | + | 198 | WP_000445281.1 | DUF957 domain-containing protein | - |
QDW95_RS03415 (697522) | 697522..698367 | + | 846 | WP_169029784.1 | DUF4942 domain-containing protein | - |
QDW95_RS03425 (698667) | 698667..699173 | + | 507 | WP_000228937.1 | G/U mismatch-specific DNA glycosylase | - |
QDW95_RS03430 (699252) | 699252..701093 | - | 1842 | WP_000437375.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14103.15 Da Isoelectric Point: 8.2904
>T277833 WP_000854722.1 NZ_CP122758:696358-696735 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQILLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASRCPSPVTIWQILLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J5ZPW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K4A940 |