Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 33027..33652 | Replicon | plasmid unnamed5 |
Accession | NZ_CP122732 | ||
Organism | Escherichia coli strain ETEC1746 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QDW99_RS24400 | Protein ID | WP_000911317.1 |
Coordinates | 33027..33425 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | L4J1D2 |
Locus tag | QDW99_RS24405 | Protein ID | WP_000450532.1 |
Coordinates | 33425..33652 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW99_RS24385 (29471) | 29471..29869 | + | 399 | WP_240992429.1 | conjugal transfer entry exclusion protein TraS | - |
QDW99_RS24390 (29883) | 29883..30614 | + | 732 | WP_024187508.1 | conjugal transfer complement resistance protein TraT | - |
QDW99_RS24395 (30865) | 30865..33018 | + | 2154 | WP_062873762.1 | type IV conjugative transfer system coupling protein TraD | - |
QDW99_RS24400 (33027) | 33027..33425 | - | 399 | WP_000911317.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QDW99_RS24405 (33425) | 33425..33652 | - | 228 | WP_000450532.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | estIa | 1..91044 | 91044 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14857.14 Da Isoelectric Point: 8.5264
>T277829 WP_000911317.1 NZ_CP122732:c33425-33027 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|