Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3566945..3567563 | Replicon | chromosome |
| Accession | NZ_CP122727 | ||
| Organism | Escherichia coli strain ETEC1746 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QDW99_RS17665 | Protein ID | WP_001291435.1 |
| Coordinates | 3567345..3567563 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QDW99_RS17660 | Protein ID | WP_000344800.1 |
| Coordinates | 3566945..3567319 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW99_RS17650 (3562034) | 3562034..3563227 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QDW99_RS17655 (3563250) | 3563250..3566399 | + | 3150 | WP_282868660.1 | efflux RND transporter permease AcrB | - |
| QDW99_RS17660 (3566945) | 3566945..3567319 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QDW99_RS17665 (3567345) | 3567345..3567563 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QDW99_RS17670 (3567735) | 3567735..3568286 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| QDW99_RS17675 (3568402) | 3568402..3568872 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| QDW99_RS17680 (3569036) | 3569036..3570586 | + | 1551 | WP_032083478.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QDW99_RS17685 (3570628) | 3570628..3570981 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| QDW99_RS17695 (3571360) | 3571360..3571671 | + | 312 | WP_032083470.1 | MGMT family protein | - |
| QDW99_RS17700 (3571702) | 3571702..3572274 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T277823 WP_001291435.1 NZ_CP122727:3567345-3567563 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT277823 WP_000344800.1 NZ_CP122727:3566945-3567319 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |