Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2851838..2852672 Replicon chromosome
Accession NZ_CP122727
Organism Escherichia coli strain ETEC1746

Toxin (Protein)


Gene name yeeV Uniprot ID W0S379
Locus tag QDW99_RS14095 Protein ID WP_000854808.1
Coordinates 2851838..2852215 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID W0S4A5
Locus tag QDW99_RS14100 Protein ID WP_001285114.1
Coordinates 2852304..2852672 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW99_RS14055 (2846845) 2846845..2847336 - 492 WP_001297187.1 DUF1097 domain-containing protein -
QDW99_RS14060 (2847438) 2847438..2847992 - 555 WP_001001921.1 molecular chaperone YcdY -
QDW99_RS14065 (2848016) 2848016..2848753 - 738 WP_000283667.1 zinc-binding phosphatase -
QDW99_RS14070 (2848808) 2848808..2849746 - 939 Protein_2760 glyoxylate/hydroxypyruvate reductase GhrA -
QDW99_RS14080 (2850217) 2850217..2851059 - 843 WP_001280436.1 DUF4942 domain-containing protein -
QDW99_RS14085 (2851144) 2851144..2851341 - 198 WP_000839248.1 DUF957 domain-containing protein -
QDW99_RS14090 (2851353) 2851353..2851841 - 489 WP_000761657.1 DUF5983 family protein -
QDW99_RS14095 (2851838) 2851838..2852215 - 378 WP_000854808.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QDW99_RS14100 (2852304) 2852304..2852672 - 369 WP_001285114.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QDW99_RS14105 (2852722) 2852722..2853369 - 648 WP_000094919.1 hypothetical protein -
QDW99_RS14110 (2853388) 2853388..2853609 - 222 WP_000692345.1 DUF987 domain-containing protein -
QDW99_RS14115 (2853678) 2853678..2854154 - 477 WP_001186747.1 RadC family protein -
QDW99_RS14120 (2854170) 2854170..2854655 - 486 WP_000214416.1 antirestriction protein -
QDW99_RS14125 (2854747) 2854747..2855565 - 819 WP_282868627.1 DUF932 domain-containing protein -
QDW99_RS14130 (2855658) 2855658..2855836 + 179 Protein_2771 hypothetical protein -
QDW99_RS14135 (2855976) 2855976..2856389 - 414 WP_000789535.1 hypothetical protein -
QDW99_RS14140 (2856659) 2856659..2857198 - 540 WP_001104020.1 DUF4339 domain-containing protein -
QDW99_RS14145 (2857323) 2857323..2857496 - 174 WP_001370911.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - csgB / csgD / csgE / csgF / csgG 2843226..2854655 11429


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13909.93 Da        Isoelectric Point: 7.9085

>T277822 WP_000854808.1 NZ_CP122727:c2852215-2851838 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13767.60 Da        Isoelectric Point: 6.9460

>AT277822 WP_001285114.1 NZ_CP122727:c2852672-2852304 [Escherichia coli]
VSDSLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQALPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCKADTLSSCGYVYLAVYPTPKMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB W0S379

Antitoxin

Source ID Structure
AlphaFold DB W0S4A5

References