Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2851838..2852672 | Replicon | chromosome |
| Accession | NZ_CP122727 | ||
| Organism | Escherichia coli strain ETEC1746 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | W0S379 |
| Locus tag | QDW99_RS14095 | Protein ID | WP_000854808.1 |
| Coordinates | 2851838..2852215 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | W0S4A5 |
| Locus tag | QDW99_RS14100 | Protein ID | WP_001285114.1 |
| Coordinates | 2852304..2852672 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW99_RS14055 (2846845) | 2846845..2847336 | - | 492 | WP_001297187.1 | DUF1097 domain-containing protein | - |
| QDW99_RS14060 (2847438) | 2847438..2847992 | - | 555 | WP_001001921.1 | molecular chaperone YcdY | - |
| QDW99_RS14065 (2848016) | 2848016..2848753 | - | 738 | WP_000283667.1 | zinc-binding phosphatase | - |
| QDW99_RS14070 (2848808) | 2848808..2849746 | - | 939 | Protein_2760 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| QDW99_RS14080 (2850217) | 2850217..2851059 | - | 843 | WP_001280436.1 | DUF4942 domain-containing protein | - |
| QDW99_RS14085 (2851144) | 2851144..2851341 | - | 198 | WP_000839248.1 | DUF957 domain-containing protein | - |
| QDW99_RS14090 (2851353) | 2851353..2851841 | - | 489 | WP_000761657.1 | DUF5983 family protein | - |
| QDW99_RS14095 (2851838) | 2851838..2852215 | - | 378 | WP_000854808.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QDW99_RS14100 (2852304) | 2852304..2852672 | - | 369 | WP_001285114.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QDW99_RS14105 (2852722) | 2852722..2853369 | - | 648 | WP_000094919.1 | hypothetical protein | - |
| QDW99_RS14110 (2853388) | 2853388..2853609 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QDW99_RS14115 (2853678) | 2853678..2854154 | - | 477 | WP_001186747.1 | RadC family protein | - |
| QDW99_RS14120 (2854170) | 2854170..2854655 | - | 486 | WP_000214416.1 | antirestriction protein | - |
| QDW99_RS14125 (2854747) | 2854747..2855565 | - | 819 | WP_282868627.1 | DUF932 domain-containing protein | - |
| QDW99_RS14130 (2855658) | 2855658..2855836 | + | 179 | Protein_2771 | hypothetical protein | - |
| QDW99_RS14135 (2855976) | 2855976..2856389 | - | 414 | WP_000789535.1 | hypothetical protein | - |
| QDW99_RS14140 (2856659) | 2856659..2857198 | - | 540 | WP_001104020.1 | DUF4339 domain-containing protein | - |
| QDW99_RS14145 (2857323) | 2857323..2857496 | - | 174 | WP_001370911.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | csgB / csgD / csgE / csgF / csgG | 2843226..2854655 | 11429 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13909.93 Da Isoelectric Point: 7.9085
>T277822 WP_000854808.1 NZ_CP122727:c2852215-2851838 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13767.60 Da Isoelectric Point: 6.9460
>AT277822 WP_001285114.1 NZ_CP122727:c2852672-2852304 [Escherichia coli]
VSDSLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQALPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCKADTLSSCGYVYLAVYPTPKMKN
VSDSLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQALPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCKADTLSSCGYVYLAVYPTPKMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|