Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 1010389..1010972 | Replicon | chromosome |
| Accession | NZ_CP122727 | ||
| Organism | Escherichia coli strain ETEC1746 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S1EZP4 |
| Locus tag | QDW99_RS04925 | Protein ID | WP_000254738.1 |
| Coordinates | 1010637..1010972 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A1V2T5M9 |
| Locus tag | QDW99_RS04920 | Protein ID | WP_000581941.1 |
| Coordinates | 1010389..1010637 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW99_RS04910 (1006728) | 1006728..1008029 | + | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| QDW99_RS04915 (1008077) | 1008077..1010311 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| QDW99_RS04920 (1010389) | 1010389..1010637 | + | 249 | WP_000581941.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| QDW99_RS04925 (1010637) | 1010637..1010972 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
| QDW99_RS04930 (1011043) | 1011043..1011834 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| QDW99_RS04935 (1012062) | 1012062..1013699 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| QDW99_RS04940 (1013787) | 1013787..1015085 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T277812 WP_000254738.1 NZ_CP122727:1010637-1010972 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|