Detailed information of TA system
Overview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 873484..874138 | Replicon | chromosome |
Accession | NZ_CP122727 | ||
Organism | Escherichia coli strain ETEC1746 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | QDW99_RS04305 | Protein ID | WP_000244777.1 |
Coordinates | 873731..874138 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | QDW99_RS04300 | Protein ID | WP_000354046.1 |
Coordinates | 873484..873750 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW99_RS04275 (868653) | 868653..869396 | + | 744 | WP_032083429.1 | SDR family oxidoreductase | - |
QDW99_RS04280 (869453) | 869453..870886 | - | 1434 | WP_282868689.1 | 6-phospho-beta-glucosidase BglA | - |
QDW99_RS04285 (870931) | 870931..871242 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
QDW99_RS04290 (871406) | 871406..872065 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
QDW99_RS04295 (872261) | 872261..873241 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
QDW99_RS04300 (873484) | 873484..873750 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
QDW99_RS04305 (873731) | 873731..874138 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
QDW99_RS04310 (874178) | 874178..874699 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
QDW99_RS04315 (874811) | 874811..875707 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
QDW99_RS04320 (875732) | 875732..876442 | + | 711 | WP_000715216.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QDW99_RS04325 (876448) | 876448..878181 | + | 1734 | WP_000813212.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T277811 WP_000244777.1 NZ_CP122727:873731-874138 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |