Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 63120..63655 Replicon plasmid unnamed2
Accession NZ_CP122724
Organism Escherichia coli strain ETEC1747

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag QDW91_RS26875 Protein ID WP_265347786.1
Coordinates 63120..63386 (-) Length 89 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag QDW91_RS26880 Protein ID WP_046788832.1
Coordinates 63386..63655 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW91_RS26845 (58891) 58891..59172 - 282 Protein_65 IS66 family insertion sequence element accessory protein TnpB -
QDW91_RS26850 (59235) 59235..59753 - 519 Protein_66 IS21-like element IS21 family helper ATPase IstB -
QDW91_RS26855 (59842) 59842..60207 + 366 WP_000124098.1 hypothetical protein -
QDW91_RS26860 (60207) 60207..61394 + 1188 WP_000937612.1 IS91-like element IS91 family transposase -
QDW91_RS26865 (61571) 61571..61861 - 291 Protein_69 ATP-binding protein -
QDW91_RS26870 (61861) 61861..63033 - 1173 Protein_70 IS21-like element IS21 family transposase -
QDW91_RS26875 (63120) 63120..63386 - 267 WP_265347786.1 type II toxin-antitoxin system toxin YacB Toxin
QDW91_RS26880 (63386) 63386..63655 - 270 WP_046788832.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
QDW91_RS26885 (63728) 63728..63868 - 141 WP_161710125.1 hypothetical protein -
QDW91_RS26890 (64568) 64568..65425 - 858 WP_063118850.1 incFII family plasmid replication initiator RepA -
QDW91_RS26895 (65418) 65418..65492 - 75 WP_001375168.1 RepA leader peptide Tap -
QDW91_RS26900 (65728) 65728..65985 - 258 WP_000083826.1 replication regulatory protein RepA -
QDW91_RS26905 (66225) 66225..66815 - 591 WP_000766805.1 DUF2726 domain-containing protein -
QDW91_RS26910 (66853) 66853..67062 - 210 WP_001298565.1 hemolysin expression modulator Hha -
QDW91_RS26915 (67108) 67108..67569 - 462 WP_001233838.1 thermonuclease family protein -
QDW91_RS26920 (67814) 67814..68026 - 213 WP_001309245.1 ANR family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - estIa / hlyD / hlyB / hlyB / hlyA / hlyC 1..130771 130771


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-85)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10343.90 Da        Isoelectric Point: 8.0167

>T277803 WP_265347786.1 NZ_CP122724:c63386-63120 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMVAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVCQRQ

Download         Length: 267 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10266.61 Da        Isoelectric Point: 7.2057

>AT277803 WP_046788832.1 NZ_CP122724:c63655-63386 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKIAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References