Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 5889..6411 Replicon plasmid unnamed2
Accession NZ_CP122724
Organism Escherichia coli strain ETEC1747

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag QDW91_RS26565 Protein ID WP_000220560.1
Coordinates 5889..6170 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag QDW91_RS26570 Protein ID WP_000121743.1
Coordinates 6160..6411 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW91_RS26525 (1536) 1536..1754 - 219 WP_001353651.1 heat-stable enterotoxin ST-I group a -
QDW91_RS26530 (2263) 2263..2412 + 150 Protein_2 transposase -
QDW91_RS26535 (2490) 2490..2948 + 459 Protein_3 transposase -
QDW91_RS26540 (2983) 2983..3348 + 366 WP_000124098.1 hypothetical protein -
QDW91_RS26545 (3348) 3348..4535 + 1188 WP_000937614.1 IS91-like element IS91 family transposase -
QDW91_RS26550 (4925) 4925..5140 - 216 WP_001180116.1 hypothetical protein -
QDW91_RS26555 (5130) 5130..5375 - 246 WP_000356545.1 hypothetical protein -
QDW91_RS26560 (5420) 5420..5743 - 324 WP_001181907.1 hypothetical protein -
QDW91_RS26565 (5889) 5889..6170 - 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QDW91_RS26570 (6160) 6160..6411 - 252 WP_000121743.1 plasmid stabilization protein Antitoxin
QDW91_RS26575 (7645) 7645..8481 + 837 WP_001050931.1 RepB family plasmid replication initiator protein -
QDW91_RS26580 (8521) 8521..8967 + 447 WP_000057426.1 hypothetical protein -
QDW91_RS26585 (9104) 9104..9460 + 357 WP_000456533.1 DNA distortion polypeptide 3 -
QDW91_RS26590 (9457) 9457..10434 - 978 WP_001269910.1 hypothetical protein -
QDW91_RS26595 (10459) 10459..10740 - 282 WP_001185482.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - estIa / hlyD / hlyB / hlyB / hlyA / hlyC 1..130771 130771


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T277802 WP_000220560.1 NZ_CP122724:c6170-5889 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT277802 WP_000121743.1 NZ_CP122724:c6411-6160 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References