Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4531079..4531911 | Replicon | chromosome |
| Accession | NZ_CP122722 | ||
| Organism | Escherichia coli strain ETEC1747 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | QDW91_RS22635 | Protein ID | WP_000854753.1 |
| Coordinates | 4531079..4531453 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | V0ULY5 |
| Locus tag | QDW91_RS22640 | Protein ID | WP_001315620.1 |
| Coordinates | 4531543..4531911 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW91_RS22600 (4526286) | 4526286..4527392 | + | 1107 | WP_001299704.1 | N-acetylneuraminate epimerase | - |
| QDW91_RS22605 (4527457) | 4527457..4528437 | + | 981 | WP_000991458.1 | sialate O-acetylesterase | - |
| QDW91_RS22610 (4528445) | 4528445..4529095 | - | 651 | WP_001037966.1 | HNH endonuclease | - |
| QDW91_RS22615 (4529232) | 4529232..4529375 | + | 144 | Protein_4430 | HNH endonuclease | - |
| QDW91_RS22620 (4530151) | 4530151..4530300 | - | 150 | Protein_4431 | hypothetical protein | - |
| QDW91_RS22625 (4530385) | 4530385..4530582 | - | 198 | WP_000839282.1 | DUF957 domain-containing protein | - |
| QDW91_RS22630 (4530594) | 4530594..4531082 | - | 489 | WP_000777548.1 | DUF5983 family protein | - |
| QDW91_RS22635 (4531079) | 4531079..4531453 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| QDW91_RS22640 (4531543) | 4531543..4531911 | - | 369 | WP_001315620.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QDW91_RS22645 (4532074) | 4532074..4532295 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QDW91_RS22650 (4532358) | 4532358..4532834 | - | 477 | WP_001186774.1 | RadC family protein | - |
| QDW91_RS22655 (4532850) | 4532850..4533335 | - | 486 | WP_000849588.1 | antirestriction protein | - |
| QDW91_RS22660 (4533390) | 4533390..4534208 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| QDW91_RS22665 (4534308) | 4534308..4534541 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| QDW91_RS22670 (4534620) | 4534620..4535075 | - | 456 | WP_000581504.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T277799 WP_000854753.1 NZ_CP122722:c4531453-4531079 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13474.20 Da Isoelectric Point: 6.2050
>AT277799 WP_001315620.1 NZ_CP122722:c4531911-4531543 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0ULY5 |