Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3402479..3403313 Replicon chromosome
Accession NZ_CP122722
Organism Escherichia coli strain ETEC1747

Toxin (Protein)


Gene name yeeV Uniprot ID W0S379
Locus tag QDW91_RS17220 Protein ID WP_000854808.1
Coordinates 3402479..3402856 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID W0S4A5
Locus tag QDW91_RS17225 Protein ID WP_001285114.1
Coordinates 3402945..3403313 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW91_RS17190 (3399160) 3399160..3399864 + 705 WP_001241678.1 leucyl/phenylalanyl-tRNA--protein transferase -
QDW91_RS17195 (3400149) 3400149..3400367 + 219 WP_001040187.1 translation initiation factor IF-1 -
QDW91_RS17205 (3400858) 3400858..3401700 - 843 WP_001280436.1 DUF4942 domain-containing protein -
QDW91_RS17210 (3401785) 3401785..3401982 - 198 WP_000839248.1 DUF957 domain-containing protein -
QDW91_RS17215 (3401994) 3401994..3402482 - 489 WP_000761657.1 DUF5983 family protein -
QDW91_RS17220 (3402479) 3402479..3402856 - 378 WP_000854808.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QDW91_RS17225 (3402945) 3402945..3403313 - 369 WP_001285114.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QDW91_RS17230 (3403363) 3403363..3404010 - 648 WP_000094919.1 hypothetical protein -
QDW91_RS17235 (3404029) 3404029..3404250 - 222 WP_000692345.1 DUF987 domain-containing protein -
QDW91_RS17240 (3404319) 3404319..3404795 - 477 WP_001186747.1 RadC family protein -
QDW91_RS17245 (3404811) 3404811..3405296 - 486 WP_000214416.1 antirestriction protein -
QDW91_RS17250 (3405388) 3405388..3406206 - 819 WP_001234743.1 DUF932 domain-containing protein -
QDW91_RS17255 (3406299) 3406299..3406477 + 179 Protein_3385 hypothetical protein -
QDW91_RS17260 (3406617) 3406617..3407030 - 414 WP_000789535.1 hypothetical protein -
QDW91_RS17265 (3407300) 3407300..3407839 - 540 WP_001104020.1 DUF4339 domain-containing protein -
QDW91_RS17270 (3407964) 3407964..3408137 - 174 WP_001370911.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13909.93 Da        Isoelectric Point: 7.9085

>T277796 WP_000854808.1 NZ_CP122722:c3402856-3402479 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13767.60 Da        Isoelectric Point: 6.9460

>AT277796 WP_001285114.1 NZ_CP122722:c3403313-3402945 [Escherichia coli]
VSDSLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQALPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCKADTLSSCGYVYLAVYPTPKMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB W0S379

Antitoxin

Source ID Structure
AlphaFold DB W0S4A5

References