Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2631193..2631719 | Replicon | chromosome |
Accession | NZ_CP122722 | ||
Organism | Escherichia coli strain ETEC1747 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | QDW91_RS13215 | Protein ID | WP_000323025.1 |
Coordinates | 2631193..2631480 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | QDW91_RS13220 | Protein ID | WP_000534858.1 |
Coordinates | 2631480..2631719 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW91_RS13165 (2626217) | 2626217..2626432 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
QDW91_RS13170 (2626652) | 2626652..2626822 | + | 171 | WP_001405948.1 | putative zinc-binding protein YnfU | - |
QDW91_RS13175 (2627186) | 2627186..2627401 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
QDW91_RS13180 (2627702) | 2627702..2627914 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
QDW91_RS13185 (2627969) | 2627969..2628058 | + | 90 | WP_120795389.1 | hypothetical protein | - |
QDW91_RS13190 (2628336) | 2628336..2629088 | - | 753 | WP_001047135.1 | antitermination protein | - |
QDW91_RS13195 (2629102) | 2629102..2630151 | - | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
QDW91_RS13200 (2630153) | 2630153..2630431 | - | 279 | WP_012304870.1 | hypothetical protein | - |
QDW91_RS13205 (2630498) | 2630498..2630749 | - | 252 | WP_000980994.1 | protein Rem | - |
QDW91_RS13210 (2630966) | 2630966..2631121 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
QDW91_RS13215 (2631193) | 2631193..2631480 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
QDW91_RS13220 (2631480) | 2631480..2631719 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
QDW91_RS13225 (2631744) | 2631744..2632049 | + | 306 | WP_001326990.1 | protein YdfV | - |
QDW91_RS13230 (2632252) | 2632252..2632584 | + | 333 | WP_001317460.1 | FlxA-like family protein | - |
QDW91_RS13235 (2633021) | 2633021..2633170 | - | 150 | WP_180302674.1 | protein YdfW | - |
QDW91_RS13240 (2633291) | 2633291..2634340 | - | 1050 | Protein_2596 | IS1202-like element ISEsa1 family transposase | - |
QDW91_RS13245 (2634395) | 2634395..2634814 | - | 420 | WP_001151195.1 | DUF977 family protein | - |
QDW91_RS13250 (2634855) | 2634855..2635817 | - | 963 | WP_282868472.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2595809..2648861 | 53052 | |
- | flank | IS/Tn | - | - | 2635890..2637098 | 1208 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T277791 WP_000323025.1 NZ_CP122722:c2631480-2631193 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|