Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 2010969..2011801 | Replicon | chromosome |
Accession | NZ_CP122722 | ||
Organism | Escherichia coli strain ETEC1747 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A7ZVJ9 |
Locus tag | QDW91_RS10010 | Protein ID | WP_000854765.1 |
Coordinates | 2010969..2011343 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A8S7UAZ9 |
Locus tag | QDW91_RS10015 | Protein ID | WP_001372808.1 |
Coordinates | 2011433..2011801 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW91_RS09975 (2006428) | 2006428..2006757 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
QDW91_RS09980 (2006858) | 2006858..2007124 | - | 267 | WP_001360325.1 | EutP/PduV family microcompartment system protein | - |
QDW91_RS09985 (2007314) | 2007314..2008096 | - | 783 | WP_001317493.1 | IS21-like element IS100kyp family helper ATPase IstB | - |
QDW91_RS09990 (2008093) | 2008093..2009115 | - | 1023 | WP_001372384.1 | IS21-like element IS100 family transposase | - |
QDW91_RS09995 (2009453) | 2009453..2009842 | - | 390 | WP_077249349.1 | transposase | - |
QDW91_RS10000 (2010640) | 2010640..2010720 | - | 81 | Protein_1961 | hypothetical protein | - |
QDW91_RS10005 (2010820) | 2010820..2010972 | - | 153 | Protein_1962 | DUF5983 family protein | - |
QDW91_RS10010 (2010969) | 2010969..2011343 | - | 375 | WP_000854765.1 | TA system toxin CbtA family protein | Toxin |
QDW91_RS10015 (2011433) | 2011433..2011801 | - | 369 | WP_001372808.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QDW91_RS10020 (2011964) | 2011964..2012186 | - | 223 | Protein_1965 | DUF987 domain-containing protein | - |
QDW91_RS10025 (2012255) | 2012255..2012731 | - | 477 | WP_001186770.1 | RadC family protein | - |
QDW91_RS10030 (2012747) | 2012747..2013220 | - | 474 | WP_001372806.1 | antirestriction protein | - |
QDW91_RS10035 (2013562) | 2013562..2014380 | - | 819 | WP_001234651.1 | DUF932 domain-containing protein | - |
QDW91_RS10040 (2014498) | 2014498..2014693 | - | 196 | Protein_1969 | DUF905 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13970.98 Da Isoelectric Point: 7.2909
>T277786 WP_000854765.1 NZ_CP122722:c2011343-2010969 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13551.25 Da Isoelectric Point: 5.4492
>AT277786 WP_001372808.1 NZ_CP122722:c2011801-2011433 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGTRLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGTRLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|