Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1461438..1462063 | Replicon | chromosome |
| Accession | NZ_CP122722 | ||
| Organism | Escherichia coli strain ETEC1747 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QDW91_RS07340 | Protein ID | WP_000911330.1 |
| Coordinates | 1461665..1462063 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | QDW91_RS07335 | Protein ID | WP_000450524.1 |
| Coordinates | 1461438..1461665 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW91_RS07310 (1457242) | 1457242..1457712 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| QDW91_RS07315 (1457712) | 1457712..1458284 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| QDW91_RS07320 (1458430) | 1458430..1459308 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| QDW91_RS07325 (1459325) | 1459325..1460359 | + | 1035 | WP_001384714.1 | outer membrane protein assembly factor BamC | - |
| QDW91_RS07330 (1460572) | 1460572..1461285 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| QDW91_RS07335 (1461438) | 1461438..1461665 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| QDW91_RS07340 (1461665) | 1461665..1462063 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QDW91_RS07345 (1462210) | 1462210..1463073 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
| QDW91_RS07350 (1463088) | 1463088..1465103 | + | 2016 | WP_000829335.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| QDW91_RS07355 (1465177) | 1465177..1465875 | + | 699 | WP_000679812.1 | esterase | - |
| QDW91_RS07360 (1465985) | 1465985..1466185 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T277784 WP_000911330.1 NZ_CP122722:1461665-1462063 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|