Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4567472..4568307 | Replicon | chromosome |
Accession | NZ_CP122719 | ||
Organism | Escherichia coli strain ETEC1748 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A3A6S2N5 |
Locus tag | QDW92_RS22540 | Protein ID | WP_000854800.1 |
Coordinates | 4567930..4568307 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A3Z2YIX3 |
Locus tag | QDW92_RS22535 | Protein ID | WP_032178229.1 |
Coordinates | 4567472..4567840 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW92_RS22510 (4564583) | 4564583..4565401 | + | 819 | WP_001234392.1 | DUF932 domain-containing protein | - |
QDW92_RS22515 (4565493) | 4565493..4565978 | + | 486 | WP_000213706.1 | antirestriction protein | - |
QDW92_RS22520 (4565993) | 4565993..4566469 | + | 477 | WP_001186784.1 | RadC family protein | - |
QDW92_RS22525 (4566538) | 4566538..4566759 | + | 222 | WP_000692353.1 | DUF987 domain-containing protein | - |
QDW92_RS22530 (4566778) | 4566778..4567422 | + | 645 | WP_000086748.1 | hypothetical protein | - |
QDW92_RS22535 (4567472) | 4567472..4567840 | + | 369 | WP_032178229.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QDW92_RS22540 (4567930) | 4567930..4568307 | + | 378 | WP_000854800.1 | TA system toxin CbtA family protein | Toxin |
QDW92_RS22545 (4568304) | 4568304..4568792 | + | 489 | WP_000779171.1 | DUF5983 family protein | - |
QDW92_RS22550 (4568804) | 4568804..4569001 | + | 198 | WP_001374283.1 | DUF957 domain-containing protein | - |
QDW92_RS22555 (4569086) | 4569086..4569928 | + | 843 | WP_063086391.1 | DUF4942 domain-containing protein | - |
QDW92_RS22560 (4570677) | 4570677..4572215 | + | 1539 | WP_001187196.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4540834..4580027 | 39193 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14068.13 Da Isoelectric Point: 9.1376
>T277772 WP_000854800.1 NZ_CP122719:4567930-4568307 [Escherichia coli]
MKTLPVLPGQAAGLRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDKPGF
NACTHSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHSEAKR
MKTLPVLPGQAAGLRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDKPGF
NACTHSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHSEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13823.58 Da Isoelectric Point: 6.3177
>AT277772 WP_032178229.1 NZ_CP122719:4567472-4567840 [Escherichia coli]
VSDTLHETNYPDDNNDRSWWGLPCTVTPCFRARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLHETNYPDDNNDRSWWGLPCTVTPCFRARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3A6S2N5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z2YIX3 |