Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3772114..3772732 | Replicon | chromosome |
Accession | NZ_CP122719 | ||
Organism | Escherichia coli strain ETEC1748 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QDW92_RS18615 | Protein ID | WP_001291435.1 |
Coordinates | 3772514..3772732 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QDW92_RS18610 | Protein ID | WP_000344800.1 |
Coordinates | 3772114..3772488 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW92_RS18600 (3767203) | 3767203..3768396 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QDW92_RS18605 (3768419) | 3768419..3771568 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
QDW92_RS18610 (3772114) | 3772114..3772488 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QDW92_RS18615 (3772514) | 3772514..3772732 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QDW92_RS18620 (3772904) | 3772904..3773455 | + | 552 | WP_063118620.1 | maltose O-acetyltransferase | - |
QDW92_RS18625 (3773571) | 3773571..3774041 | + | 471 | WP_063085325.1 | YlaC family protein | - |
QDW92_RS18630 (3774205) | 3774205..3775755 | + | 1551 | WP_063085326.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QDW92_RS18635 (3775797) | 3775797..3776150 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
QDW92_RS18645 (3776529) | 3776529..3776840 | + | 312 | WP_000409911.1 | MGMT family protein | - |
QDW92_RS18650 (3776871) | 3776871..3777443 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T277768 WP_001291435.1 NZ_CP122719:3772514-3772732 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT277768 WP_000344800.1 NZ_CP122719:3772114-3772488 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |