Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3082230..3083064 | Replicon | chromosome |
| Accession | NZ_CP122719 | ||
| Organism | Escherichia coli strain ETEC1748 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A3S7R4W2 |
| Locus tag | QDW92_RS15380 | Protein ID | WP_063085447.1 |
| Coordinates | 3082230..3082607 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A2J4HRK6 |
| Locus tag | QDW92_RS15385 | Protein ID | WP_001354276.1 |
| Coordinates | 3082696..3083064 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW92_RS15340 (3077615) | 3077615..3078448 | + | 834 | WP_001189321.1 | curli production assembly/transport protein CsgG | - |
| QDW92_RS15345 (3078513) | 3078513..3079004 | - | 492 | WP_032140678.1 | DUF1097 domain-containing protein | - |
| QDW92_RS15350 (3079106) | 3079106..3079660 | - | 555 | WP_063085449.1 | molecular chaperone YcdY | - |
| QDW92_RS15355 (3079684) | 3079684..3080421 | - | 738 | WP_000283664.1 | zinc-binding phosphatase | - |
| QDW92_RS15360 (3080476) | 3080476..3081414 | - | 939 | WP_001357083.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| QDW92_RS15370 (3081883) | 3081883..3082125 | - | 243 | WP_242378885.1 | DUF4942 domain-containing protein | - |
| QDW92_RS15375 (3082105) | 3082105..3082233 | - | 129 | Protein_3013 | DUF5983 family protein | - |
| QDW92_RS15380 (3082230) | 3082230..3082607 | - | 378 | WP_063085447.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QDW92_RS15385 (3082696) | 3082696..3083064 | - | 369 | WP_001354276.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QDW92_RS15390 (3083321) | 3083321..3083617 | - | 297 | Protein_3016 | antirestriction protein | - |
| QDW92_RS15395 (3083586) | 3083586..3084458 | - | 873 | Protein_3017 | AIDA repeat-containing protein | - |
| QDW92_RS15400 (3084831) | 3084831..3085703 | - | 873 | WP_053271975.1 | GTPase family protein | - |
| QDW92_RS15405 (3085967) | 3085967..3087523 | + | 1557 | WP_086186061.1 | type I restriction-modification system subunit M | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13908.94 Da Isoelectric Point: 8.5222
>T277766 WP_063085447.1 NZ_CP122719:c3082607-3082230 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNNTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNNTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13649.47 Da Isoelectric Point: 7.0261
>AT277766 WP_001354276.1 NZ_CP122719:c3083064-3082696 [Escherichia coli]
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCKADTLSSCGYVYLAVYPTPKMKN
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCKADTLSSCGYVYLAVYPTPKMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S7R4W2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4HRK6 |